KEGG   Clostridium sp. BNL1100: Clo1100_0483Help
Entry
Clo1100_0483      CDS       T01708                                 

Definition
ABC transporter
Orthology
K01992  
ABC-2 type transport system permease protein
Organism
clb  Clostridium sp. BNL1100
Module
ABC-2 type transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523849..524976
Genome map
AA seq 375 aa AA seqDB search
MNTLYIAYYTIKRIMLDKRTNIMKILIPIVAIVILGVALKGSFELSNMDIIKVGYLNLDN
GKQGETLVKILKEDKSIKELISLVQVDSVDKAEKMISDDKISSLIFIDKNYTKQIESGEK
SSVTIYSSKYSDYKLTVVQNIMDSYVNIVNTNIAVAMVTGKPAEYSSSSSIKEIPISING
NRPKAIDYYAVTILVLSLLSGAAFGCELVGEDYIGIMGKRIKSTPVSPVQQYAGKMIGAC
LSNFVQGLVMVLFTKFVLKANWGSNIFIILAFTLLVAVFATAIGAMLCIMFNDVNRAGAL
SSLLVPIFTFIAGGYIKIDFGPIKYLSPNQWAHTAFFNTIYNGDQHLVVTNVLALLIATV
VISTVSIILARRRTN
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaatacattatatattgcttattatacaataaaaagaatcatgttggataaaaggacc
aatataatgaaaatattgattccgattgtcgccatagtaatattgggtgtggcattaaaa
ggctcttttgagctatccaacatggatattataaaagtagggtacctgaatcttgataat
ggaaaacagggagagacccttgtaaaaatcttaaaagaggataaatccattaaagaatta
ataagtcttgttcaggttgattctgttgataaagctgaaaaaatgatttctgatgataaa
atatcatcgcttatatttattgataaaaattatacgaagcaaatagaaagcggtgagaaa
tcaagtgttacaatatactccagcaaatattcagactacaaactgacagtagtacagaac
attatggattcgtatgtcaatattgttaacacaaatatagcggttgccatggtaacaggt
aaacctgcagaatacagttcttcttccagtattaaggaaatacctatttcaatcaacggt
aacaggccaaaagctattgactattacgcagttacgatactcgtgctgtcgctactatcg
ggtgcggcatttggatgtgagctggtgggagaagattacataggaataatgggaaagagg
attaaaagcactccggttagtccagttcaacaatatgcaggaaagatgataggggcatgc
ctttcaaactttgtgcagggtcttgtcatggtcttatttacaaagtttgttcttaaggcc
aattggggaagcaatatattcataatattagctttcacgttactggtggcagtatttgct
acagcgataggtgctatgttatgcataatgttcaatgatgtaaaccgtgcaggggcttta
tcaagtctacttgttccgatatttacattcattgcaggagggtatataaaaattgatttt
ggacctattaaatacctttcaccaaaccaatgggcacatacagcattttttaataccatt
tacaatggggatcagcatctggtagtaaccaatgttcttgcgttacttatagctaccgtt
gttatttcgactgtttctattatattggcaaggaggagaacaaattga

DBGET integrated database retrieval system