KEGG   Clostridium sp. BNL1100: Clo1100_0592Help
Entry
Clo1100_0592      CDS       T01708                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
clb  Clostridium sp. BNL1100
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Clo1100_0592
Enzymes [BR:clb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Clo1100_0592
Peptidases [BR:clb01002]
 Cysteine Peptidases
  Family C44
   Clo1100_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
650767..652632
Genome map
AA seq 621 aa AA seqDB search
MCGISGIFKTTGHEQINRQEIFDMMDVLEHRGPDDSGHRLREYYGLGFRRLSIIDLQSGN
QPIENEDGTICVICNGEIFNHIELREELRKKGHVFRSKSDVEVLVHLYEDLGERFLDRIN
GQFALAIIDEKRRSIMLARDQFGVMPLFYTLVDGTLLFASEIKALLTNPLVRREVDLVGM
DQFFSLPHTVSPRTMFKNIKNLAPGHLMYAEAGKPDLILNQYWDLDYPLLNEEIERHSES
YYMERIEELLLQSIKFRTRADVDVGAFLSGGLDSSLIVCMMKALSQNRRKIFSVDFENEE
FSERKYQKIVADQLEYEHYSVPFKVDDIAERLEKVIYHTEAPVKESYNSATMALAAKARQ
QGIKVILTGEGSDELFAGYPSYRFDQFRKLRNQNDLSSAEEKMLRNKVWGDPLFKYEADF
LKLKEDKKAVYSQQLNGCFDDFDFTNHQLVNQSKIAGRHLIHQRSYIDLKVRLMDHLVSD
HSDRMLMASSVEGRFPFLDIDLVNFIRTVPPDLKLNNFKEKYILKQTAKKFVPEAIINRE
KYIFIAPGSPFLLRKNYDWINDLLSYETIKRQGYFNADEVERLKKKYLDPDFSLKTSIDT
DYMLMIIMFCLFIKKFDMPSL
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatcagcggtatatttaagacaacaggacatgaacaaataaacagacaagaa
atatttgacatgatggacgtacttgagcatcgagggcctgacgattccggccacaggctt
agagaatattacggacttggtttccgaagattgagtataattgatctgcagtcgggtaac
cagcccattgaaaacgaagacggcaccatctgtgttatttgcaatggggaaatattcaat
catatagagttgagagaagaacttcgtaaaaaaggacatgtgttcagaagcaaatcagat
gttgaagttttagtgcatctgtatgaggatttgggtgaaaggtttctggacagaataaac
ggccagtttgcgttggctattattgatgaaaaacgacgaagtattatgctggctagagac
cagtttggagtaatgcctttattctacactcttgtggacggcactttgttgtttgcatca
gagataaaggcattacttactaatccgctggtaagaagggaagtagacctggtcggaatg
gaccagttcttttctctgccgcacacggttagtcccagaacaatgttcaaaaacatcaaa
aaccttgctcccggtcacttgatgtatgcagaagccgggaaacccgatttgattttaaac
caatactgggatttggattatccgctgttaaatgaggaaattgagcggcatagtgagtca
tactatatggaacggattgaagaactgcttttgcaatcaattaagttccgtaccagagcc
gatgtagatgtaggtgcattcttaagtgggggacttgattcttcgctaattgtatgcatg
atgaaggcattgtctcagaacagaagaaagatattttcagtagattttgagaacgaagaa
ttttcagagcgaaaatatcagaaaattgtggctgaccagttggagtatgaacactattct
gtaccgttcaaagtggatgacatcgcagagagattggaaaaggtaatataccataccgaa
gcacctgtaaaagaatcctataattctgcaacaatggctctggcagcgaaggccagacag
cagggaattaaagttattttgacaggtgaggggtcggacgagctgtttgcagggtatccc
agttaccgcttcgaccagttcagaaagctgagaaaccaaaacgatttatcttctgctgag
gagaaaatgctgcgtaataaggtatggggtgacccgttattcaaatatgaagcagatttc
ttaaagctgaaggaagataaaaaagcagtttatagtcagcagttaaatggttgctttgat
gattttgattttacaaaccatcagttagtaaatcaatcaaaaatagcaggaaggcatctt
attcatcagaggtcatacatagatttaaaggttcgactcatggatcatctggtatccgat
cacagtgacagaatgctgatggcaagttctgttgaaggtagatttccatttctggatatt
gatttggttaactttataagaacggttcctcccgatttaaaactaaataattttaaggaa
aaatacatattgaagcagaccgcaaaaaaatttgtacctgaagcaattattaacagggaa
aagtatattttcattgcccccggaagcccgttcctgttaagaaaaaactacgattggata
aatgatttgctttcatatgaaaccattaaacggcaaggctatttcaatgccgacgaagta
gagagattaaagaaaaagtacttagatcccgacttttctctgaagacatcaattgataca
gattatatgctaatgattattatgttttgcttgtttattaaaaaatttgatatgccatct
ttataa

DBGET integrated database retrieval system