KEGG   Clostridium sp. BNL1100: Clo1100_0612Help
Entry
Clo1100_0612      CDS       T01708                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:clb00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674630..676126
Genome map
AA seq 498 aa AA seqDB search
MHKRYILSLDQGTTSSRAVIFDSLNGNIAGIKNVPLQQYYPQPGWVEHDAEDIFRDQMAA
ITGAIKMAGISPEAIACIGITNQRETVVVWDKNTGKPLHRAIVWQCRRSSEICDSLKMAG
LRDKIKSKTGLVIDAYFSGTKIKWILDQVEGAKDKAQRGELLAGTIDSWLIWNLTGGRKH
ITDYSNASRTMLYNINDLKWDEELLKELEIPACMLPEVVSSSGVCAYSNEKILGAKIPIS
GIAGDQHASLFGQACFKQGDAKNTYGTGCFILMNTGKSLVPSKNNLLTTIAWGIDNQVEY
ALEGSVFNAGAAIQWLRDELGIIKTAHESDIEAEKVPDTGGVYVVPAFTGLGAPYWDMYA
RGTILGITRGTNKRHIIRATLESIAYQSRDVLKAMELDSGIELNALKVDGGASASDFLMQ
FQADILDIPVQRPVIRETTALGSAFLAGLGVGIWTSKEEIEKAWNLDKTYVPIGNKKYFD
GLYLKWKKAVEKSMKWDI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcataagagatacattttatcccttgaccaggggactaccagctccagagcagtaata
tttgacagcttaaacggtaatatagccggaataaagaatgtgccgttgcagcagtattat
cctcagcccgggtgggttgagcatgatgctgaagatatattcagagaccagatggctgct
ataactggagcaataaagatggccggaataagtcctgaagcaatagcttgcatcggtatc
acaaaccagagggagaccgtagttgtctgggacaaaaacacaggaaaacctttacataga
gccattgtgtggcagtgcaggagaagttctgaaatttgtgacagtttaaagatggctggc
ttgagagataaaatcaaaagcaaaaccgggctggtaatagatgcatatttttcgggaacc
aagataaaatggattttggatcaggttgagggagcgaaggataaggctcaaaggggagag
ctccttgccggaaccatagattcatggcttatctggaatttaaccgggggtagaaagcac
atcacggattattcaaatgcatccagaaccatgctatataatataaatgatttaaaatgg
gatgaagaattgctgaaagaactggagataccggcgtgtatgttgccggaagtagtttca
tcatccggggtatgtgcgtattcaaatgaaaaaattctaggagcaaaaatccctatttcc
ggaatagccggagaccagcatgcatctcttttcgggcaagcctgctttaaacagggcgat
gcaaaaaatacgtatggtaccggctgttttattctgatgaatactggaaagtcacttgta
ccttcaaaaaacaatcttcttactactattgcatggggtatcgataatcaggtggaatat
gcacttgaaggcagtgtattcaatgccggagcagccattcagtggttaagagatgaactt
ggcataataaagaccgcacatgaaagtgatattgaggcagaaaaagttccagacactggt
ggagtatatgttgttcctgcatttacgggattaggtgcgccgtactgggatatgtatgcc
cgtggtacaattctggggataaccagagggacaaacaagaggcatattattagggccacc
ctggagtccatagcatatcagagcagggatgtactgaaagctatggaactggattcaggg
atagagctaaatgcactcaaggtagacggaggtgcaagcgcaagcgactttcttatgcag
tttcaggcagatatactggatatacctgtccaaaggcctgtaataagggaaacaacagca
cttggttctgcatttttggcgggactcggagttgggatatggacatccaaggaagagatt
gaaaaggcatggaatcttgacaagacatatgtgcctataggaaataaaaaatactttgac
ggtctatacttaaagtggaagaaagcggttgaaaaatcaatgaaatgggatatttag

DBGET integrated database retrieval system