KEGG   Clostridium sp. BNL1100: Clo1100_0768Help
Entry
Clo1100_0768      CDS       T01708                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
clb  Clostridium sp. BNL1100
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:clb00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
859978..862032
Genome map
AA seq 684 aa AA seqDB search
MDKYMPICNKFPHILHGGDYNPEQWLETPKIIDEDFRLMKLAHCNAMTVGIFSWMALEPE
EGKYNFGWLDSIMDRLAQNGMAAILATPSGAKPNWMSQKYPEILRTQADRLKDLHGGRHN
HCFTSPIYRKKVSRINRMLAERYAKHPALILWHISNEYSGECHCPLCQEAFRSFLRNKYA
GDLEKLNHEWWTGFWAHRYTDWSQIESPSPRGENETHGLILDWKRFVSHQTIDFFKNEIK
PLRELTPDVPVTTNMMGTFPGIEYRELAKELDVVSWDSYPTWHTTEQPDWKIGVRTSFIH
DLNRSLKQGKPFMMMESTPSTVNWQKVNKLKRPGMHMLSSLQALAHGSDTVQYFQWRKSR
GSFEKFHGAVVDHVGHENTRVFRDVSQVGQALEKLDELVGTTVHPQVAIIFDWENRWAIE
EAQALARDRIQYEETCILHYTAFWMQGVTVDIIGAREDFSQYKLVIAPMLYMTHPGVGER
IEAFVREGGTFVTTYWSGIVNENDLCHLGGFPGPLRTVTGIWSEEIDALHPDENNSLLIS
KNSLGLSGSYRVQDFCELIHAESAQVLAVYGDDFYQGRPALTVNRFGKGDAYYMAARTGE
DFLDNFYNTLMEKLSLTRTMEAKLPRGVTAQHRTDGQNRYIFIMNFNAKKEEISLTGIYT
DMLTGEERQGVIELDPFDVKVLKL
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggataaatatatgcctatttgcaacaagtttcctcatatcctccacggtggagattac
aacccggagcagtggttggagacgccaaagataatagatgaggattttcgtcttatgaag
cttgcccactgtaatgcaatgacggttggaattttttcgtggatggcactggagccggaa
gagggcaagtataattttggttggctggacagtattatggataggcttgcccaaaacgga
atggctgctattctggctactcctagcggtgcaaaacccaactggatgtcgcaaaaatac
ccggaaatattgcgtactcaggccgacaggttaaaggatttacatggaggacgtcataac
cattgttttacctcaccaatttaccgtaaaaaggtaagccggataaatcgtatgttggcg
gaacgttatgcaaagcatcccgcactaattttatggcatatctcaaatgaatacagtggg
gaatgtcattgtccgttatgtcaggaagcatttcgcagttttcttcgaaacaagtatgct
ggtgaccttgaaaagctcaaccatgagtggtggacgggcttctgggcacaccggtataca
gattggtcacaaattgagtcgccatctccacggggtgagaatgagactcatggacttatt
ctggattggaagaggtttgtctcacaccagacaattgacttttttaaaaacgaaataaaa
cccttacgggaattaacaccggacgttcctgttactacaaatatgatgggaacctttccg
ggtatagaatacagggaacttgcaaaagagctggatgtggtttcctgggatagttatccc
acctggcacaccacggagcaaccggattggaaaatcggtgtacgaacttcctttatccat
gaccttaacaggtctctcaaacagggtaaaccatttatgatgatggaaagtacaccaagt
actgttaactggcaaaaggtaaacaagctaaagcgccccggcatgcatatgctatcgtca
ttgcaggcattggcccatggcagtgacacagttcagtactttcagtggcgaaaatcacgg
gggagctttgaaaaattccatggtgcggtggtagatcatgtgggacatgagaacactcgt
gtgttcagggatgtttcacaggtggggcaagcacttgaaaaactggatgaacttgtggga
actacggttcatccgcaggttgctataatatttgattgggaaaaccgatgggccatagag
gaagcacaggcacttgctcgtgacaggatacagtatgaggaaacctgtatattacattat
acagccttttggatgcaaggggtaaccgtagacattataggtgccagagaagatttctca
cagtacaagcttgttattgcacctatgctctatatgacccatcccggcgtcggagagcgt
attgaggcttttgttagggagggaggaacctttgttaccacctattggagcggaattgta
aatgagaatgacctatgtcatttggggggattcccggggccgctgcgtacagtcacgggt
atttggagcgaggaaatagatgctctgcacccggatgaaaacaatagtcttttaattagt
aaaaactctctgggcctttccggctcttatagagttcaggacttctgtgagttaatccac
gcagaatctgcacaggttctggctgtgtatggtgacgatttttaccaagggcggccggct
cttacggttaaccgttttggaaaaggagatgcctactacatggcagcccgtacaggagaa
gatttccttgataatttttacaatacccttatggaaaagttatcacttacacgtacaatg
gaagcgaagctgccaaggggagtaacagcccaacatcgtactgatggacaaaaccgctac
atatttataatgaatttcaatgcaaaaaaggaagagatttctcttaccgggatttacaca
gatatgcttaccggggaagaacggcaaggagttatagaacttgatccctttgacgtaaaa
gtcctaaagctataa

DBGET integrated database retrieval system