KEGG   Clostridium sp. BNL1100: Clo1100_0910Help
Entry
Clo1100_0910      CDS       T01708                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
clb  Clostridium sp. BNL1100
Brite
Enzymes [BR:clb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Clo1100_0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1072173..1073798
Genome map
AA seq 541 aa AA seqDB search
MINKSKNRKFRIFSILFSALLCTCIINSSLPLTADAAMATGKAKFVGNIWYDGNPPSKFG
DYWNQITPENATKWGSCESQQGVYNFSQAKAMYNYCKTNKIPFKFHTLIWGSQYPNWLGN
LSGSARKTAIENWYKAAAQNFPDAEYIDVVNEAMPGHAPFPYKNDIGGDNGLYGTGWDWI
VWSFEMARKYFPNSKLLINDYNVLNEWSCLDQYIPVVKILKARNLIDGVGCQSHSLENTS
AANLKSRLDKLAATGVPIYISELDLNIADDNTQKNKMQELFPVMYEHSAVKGITIWGYLQ
GHTWISNSHLIRSDGSERPAMTWLKQYMASVPGDNTPVEPRSAFTKLEAESYNDQSGIQN
VTCDEGTEAVGYTENGDYTVYKSIDFGSGATSFQVRVSSATSGGNIEIRLDSATGTLVGT
CPVAGTSGWQVFTDAKCSVSGVSGKHDLYLKFTGGSGYLFNLNWFMFGNTPASTDKIGDL
NSDGQIDALDFQVLKKCILGTGTVENTKLADLDASGTIDALDFVLMKQYLLGQITIFPAD
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgattaacaaaagtaaaaaccgtaagttcagaattttcagtattctgttttcagcactt
ttgtgtacttgcattatcaacagtagtttaccactgacagcagatgctgcaatggccaca
ggaaaggctaaatttgttggaaacatatggtatgacggtaatccaccaagtaagtttgga
gactattggaaccagattacacctgaaaatgctaccaagtggggttcatgcgaatcacag
cagggtgtatacaattttagtcaggctaaagcaatgtacaattactgtaaaacaaacaaa
attccttttaagttccatacacttatatggggttcacagtatccaaactggctaggcaat
ctttccggttcagcaagaaaaacagccatcgaaaactggtataaagctgctgcacagaat
tttccggatgcagaatacattgatgttgtaaatgaagcaatgcctggacatgctccattc
ccatacaaaaatgatatcggtggcgacaatggcctctatggcacaggatgggattggatt
gtatggtcctttgaaatggctcgtaagtatttcccaaattcaaagctgttgattaatgac
tataatgttttgaatgagtggtcttgtcttgatcaatacataccggttgtaaaaatatta
aaggccagaaacctcattgatggtgttggctgtcaatcacacagccttgaaaatacaagt
gctgcaaatctaaagtcaagactggacaaacttgctgcaacaggtgtacctatttacatt
tctgaattggatttaaatattgcagatgacaatacacagaaaaacaagatgcaggaactt
ttccctgttatgtatgaacattctgcagtaaaaggtattactatctggggttacttacaa
ggacatacctggatttcaaattctcaccttatacgcagtgatggatctgaaagacctgca
atgacttggttaaaacaatatatggcaagtgttccgggtgacaacacaccggtagaacca
agaagtgcatttacaaaacttgaagcagagagctataacgatcaatccggaatacagaac
gttacatgtgacgaaggaacagaggctgtcggatataccgaaaacggtgattacactgtt
tacaaaagcatagacttcggaagtggtgctacaagcttccaagtcagagtatcaagtgca
acaagcggaggtaatattgaaatcaggttagatagtgctaccggaaccttggtagggact
tgtccggttgccggaacaagcggttggcaggtatttaccgatgccaagtgcagcgttagc
ggtgtaagcggaaagcatgacctgtatctgaaattcacaggaggaagcggttacttattt
aatctaaattggttcatgtttggaaatactcctgcttctacagacaaaataggtgatttg
aattccgatggacaaatagatgcactggacttccaagtcttgaaaaagtgtattttaggc
acaggaacagttgaaaatacaaaacttgccgatttagatgccagcggcacaattgatgca
cttgactttgttcttatgaaacaatatctacttgggcaaataacaatatttccagctgac
aaataa

DBGET integrated database retrieval system