KEGG   Clostridium sp. BNL1100: Clo1100_0917Help
Entry
Clo1100_0917      CDS       T01708                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
clb  Clostridium sp. BNL1100
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:clb00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:clb00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:clb00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1085510..1087321
Genome map
AA seq 603 aa AA seqDB search
MKKVRAVISLVLLGLTFTIIMALNTGAWDNNLAKTPPMGWNSWNIFHGDINETKIKQIAD
TMVSSGMKDVGYVYLNLDDNWMANPARDSNGNLRADPTRFPNGIKALADYVHAKGLKLGI
YGCRGTMTCMNVPQSGSKGYEDRDAKTFASWGIDYLKYDNCNIPNGSDMKTDYQKMQTAL
ANCGRPIVFSICAWGYQSWMPATGNLWRTTGDIADKWDNGTEWFKGIINAIDGNAQYASS
AVPGAWNDPDMLEIGNGGCTTEEYRTQMSMWSMMASPLIAGNDIRTMSQTTKDILMNKEV
IAIDQDPAGVQGKRVKSANGLEIWVKPLGTNGTTKAVALLNRNSATSNITVNWSDIGVSG
SVTVRDLWAKADKGSFTGSYTASVPSHGTVLLKISTEPPAPVDATKQIEAESYSNQSGIQ
TETCSEGGEDVGYIENGDYTVYNNVDFGNGVGGFQARVASATSGGNIEIRLDSATGTLIG
TCPIAANGNWQTYTDAKCVVSGVTGKHDVYLVFTGGSGYLFNLNWFTFTPGSVNTGTLGD
LNSDGQVDAIDLQLLKKYLLGLGEIEDTKLADLDANGDINAIDFSLLKQFILGTITSFPG
EKV
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttcgtgcggttatttcacttgtccttttagggcttacatttactataata
atggccctgaataccggggcatgggataacaatcttgccaaaacgccaccgatggggtgg
aacagttggaatatcttccatggagatattaatgaaactaagattaaacagattgccgat
acaatggtaagttcaggaatgaaggatgtaggctatgtgtacctgaatctggatgataac
tggatggcaaatccggcacgtgattccaacggaaacctgcgagccgaccctacacgtttt
ccaaacgggattaaggctttagcggattatgtacatgcaaagggccttaaactcggaata
tatggatgccgtggaaccatgacctgtatgaatgttcctcaaagcggaagcaaaggctat
gaggacagagatgcaaagacatttgcttcatggggcattgattaccttaaatatgataac
tgcaatataccaaacggtagtgacatgaaaaccgattaccagaaaatgcagaccgctctt
gcaaattgcggaaggccaatcgtattcagcatatgtgcatggggatatcagagttggatg
cctgcaacgggtaatttatggcgtactaccggtgatatcgctgataagtgggataacgga
accgaatggttcaaaggtattattaatgcaattgatggtaatgcccaatacgcaagttca
gctgttcccggagcatggaatgatcctgatatgcttgaaatcggaaacggtggatgtaca
acagaggaataccgtacacagatgagcatgtggagtatgatggcatctcccctaattgca
ggaaatgatataaggaccatgtcacagaccacaaaggatattttaatgaataaggaagta
atagcaatagaccaggaccctgcaggagttcaggggaaaagggttaaaagtgcaaatggt
ctggagatttgggtaaaaccactgggtacaaatgggacaactaaggcagttgctttattg
aacaggaattcggcaacatccaatattacagttaattggtcagacataggtgtaagtgga
agtgttacggtgagagatttgtgggctaaagctgacaaaggcagttttactggctcatat
acagcatctgttccttcacatggaacagttttgcttaagatttccactgaaccaccggca
cctgttgatgctacaaagcaaatagaagcagagagttacagcaatcagtcaggaatccag
acagaaacctgttcggaaggtggagaggatgtaggatatattgaaaacggggactatact
gtatacaacaatgtagatttcggtaatggtgtcggaggcttccaagcaagagtagcaagt
gcaaccagtggaggcaacattgaaatacggcttgacagtgctacaggcactctgatagga
acatgtcctattgctgcaaacggaaattggcagacttatactgatgcaaaatgcgtagtc
agcggggtaacaggaaaacatgatgtataccttgtatttacaggaggcagcggatattta
ttcaaccttaattggtttacatttactccaggcagtgtcaatacgggaacattgggtgat
ttaaattctgacggacaagtagacgcaatagacttacagttattgaaaaagtatcttctg
ggattaggagaaattgaagatacaaagctggccgatttggatgccaacggggatattaat
gcaatagatttttcacttctgaaacaatttatattgggcacgataaccagttttccggga
gaaaaagtataa

DBGET integrated database retrieval system