KEGG   Clostridium sp. BNL1100: Clo1100_0927Help
Entry
Clo1100_0927      CDS       T01708                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
clb  Clostridium sp. BNL1100
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clo1100_0927
   00500 Starch and sucrose metabolism
    Clo1100_0927
Enzymes [BR:clb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Clo1100_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1104123..1105787
Genome map
AA seq 554 aa AA seqDB search
MKRDRFFQLVLILIFVLQTMVSSFLMCKVGAVSYDMVVAKDGSGNYTTVQAAINSVPSNS
QTRTTIYIKNGTYKERINIPSSKINVSLIGQSRTGTILTYNDAASTKTSSGGTLGTTGSA
SVTIAGAGFQAENITFENLYDEAANGSSQAVAVLAKADKMIFRGCSFKGNQDTLYANGDA
CRQYYYNCYIEGDVDFIFGSANAVFDSCEIFSLNRSGGCVTAPSTKASQKGYLIYKCKLT
SSASPKTIYLGRPWIPSSDTVQTTPKVLYRECELGSHIADAGWTVMSGNNPANFEMWEYQ
NTGAGANTSRKQLPSSKAAEYTMEKFLSGSDGWNPNLNENIPVPIPDGQYIKSLVVNDTL
NAPNWSVQSNLQVGDVIYGDRVYKFTQIPQSLMGCEWIRTACDSKMYSSDEASFLAKSDI
TVYVGLDTRVTSIPVWLSSWTATVETLVSDNNAVAYKLYKKDLPANSFVALGTNGASSST
VNYAVIVKSQTADVLVGDVNDDGTVSALDFALLRKYILTGISDGINLTAADVNADGTVNA
LDYALLKSYLLNGN
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagatagattttttcagttagttttgattcttatttttgtgcttcaaactatg
gttagctcatttttaatgtgtaaagtgggagcagtgtcctatgatatggttgtagcaaag
gacggaagcggtaattatactacggtacaggcagctataaatagtgtaccgtccaatagc
caaaccagaacaaccatatacattaaaaacggtacatataaagaaagaatcaatattccg
tcatctaaaattaatgtttcattaattggacaaagtagaacaggcacgattttaacttac
aacgatgcagccagtaccaaaacttcttccggcggaacattaggtacgacgggaagtgcc
agcgttactattgcaggagcaggttttcaggctgagaacataacttttgaaaatttatat
gatgaggcagccaacggcagcagtcaggctgtggctgtgcttgctaaagcagacaagatg
atattcagaggatgttccttcaaaggtaatcaggacaccctgtatgcaaacggggatgct
tgcaggcagtattactacaactgttatattgagggcgatgtggatttcatatttggctcg
gcaaatgcggtatttgacagctgtgaaattttttccctcaacagaagtggaggatgtgtt
acggcacccagcaccaaggcaagtcagaagggatatcttatatacaaatgtaagctgaca
agcagtgcgagtcccaaaaccatttatctcggaagaccttggatacccagttctgacact
gttcagacaaccccaaaggtattgtaccgggaatgcgaattaggctcacatattgctgat
gcaggatggactgtcatgtcaggcaataatcctgcaaactttgaaatgtgggagtatcag
aataccggtgcaggtgcaaatacatccagaaagcagctgccttcctcaaaggcagcagag
tatacaatggagaaattcctttcagggtcggacggttggaatcccaatttaaacgaaaat
atacctgtgccgattccggacggacaatacataaaatcactggttgtaaacgatacccta
aatgccccaaactggtctgttcagtcaaatttgcaggtgggagacgtaatatacggtgac
agggtatataaatttacacagattccacaaagtcttatggggtgtgaatggattaggaca
gcatgtgattcaaaaatgtattcgtcagatgaagcctcctttttagcaaaatcagatata
acggtttatgttggcttggataccagagtaacaagtattcccgtatggctaagcagttgg
actgcgacggttgagaccttggtaagtgataataatgcggttgcttacaagctgtacaaa
aaggatttaccagcaaattcatttgtggcactgggaactaacggagcgtcctcaagtacc
gtaaattatgcggttattgtaaagtctcaaacagctgatgtccttgtaggtgatgtaaat
gatgatggaacagtaagtgccttggattttgcgctactgaggaagtacatattgaccggg
atatctgacggtataaatttaacagctgcagatgtgaatgccgacggtactgtaaatgct
ttggattatgcactgttgaagagctatttattaaatggtaattaa

DBGET integrated database retrieval system