KEGG   Clostridium sp. BNL1100: Clo1100_0958Help
Entry
Clo1100_0958      CDS       T01708                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
clb  Clostridium sp. BNL1100
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Clo1100_0958
Enzymes [BR:clb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Clo1100_0958
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Clo1100_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1145059..1146573
Genome map
AA seq 504 aa AA seqDB search
MKHGFVALVGAGPGDKGLITLRGAELLSQADVVVYDRLVSEEIIKMIPSKAEKIDVGKEN
KFHPVKQEEINQILLKKSLEGNDVIRLKGGDPFVFGRGGEELELLYENNIPFEVVPGVTS
AVAALCYGGIPATHRDFCSSLHIITGHAREGGQLSIPFSELKELNGTLVFLMGLSSLSYL
MKGLINAGMDKDMPAAIVENGTRPNQRKLVATVGTLEQQAMELGIKSPAIIAVGKVCTLS
DKFNWFMKRPLFGAKILVTRPKASSGTLVEKLRQLGAEPVEYPCIEVVPIPHNEKLYRTC
ENLNEYGWILFTSKNGIQIFFDYLNSKGLDARVLANIKIGTVGSQTAKALKEVGLISDFT
PEIFDGSHLALGIAKLVGENEKVLICDAAIASDDIVNIFKSNNIKFDRVPLYYTNYINEN
SDEVRKLIVDGELKYITFTSASTVEGFIASMKDISLESLTAVCIGNQTAEAAKKYKLRYV
VAEKSTIDSMIDKLLEIGGGIIYD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatggatttgtggccttagttggtgcaggaccgggagataaggggcttattaca
ttaaggggagcggaacttctctcccaggctgatgtggtagtgtatgaccgactggtatcg
gaagaaattattaaaatgattccatctaaggcagaaaagatagatgtgggaaaagagaat
aaattccaccctgttaaacaggaagaaattaaccagatactcctaaaaaagtcactggaa
ggaaatgacgttataaggcttaaaggaggagatcctttcgtatttggcaggggaggagaa
gaacttgaactcctgtatgaaaataatattccctttgaggttgttccaggagtaacttcg
gcagtggcagcactgtgctacggagggataccggctacccacagagatttttgttcttcg
ttgcatattattaccgggcatgccagagagggaggtcagctttctattccatttagtgaa
ttaaaggaattaaatggaactctggtttttctcatgggattatcctcactatcatatctg
atgaagggacttattaatgcgggtatggataaggacatgcctgctgccatagtagagaac
ggaacaaggccaaaccagagaaaactggtagctactgttggtacattagaacaacaggct
atggagttgggaataaaatctcctgccattattgctgtaggaaaggtttgcactctttct
gataaattcaattggtttatgaagagacccctcttcggtgcaaaaatacttgttacaaga
cctaaggcatcttcgggtacacttgtggaaaagcttcgtcaactgggtgcggagcctgta
gagtatccttgtatagaggtggtacctataccacataatgaaaaactttaccgtacttgt
gaaaatctcaatgaatacggctggattttatttaccagtaaaaacggtatacagatattt
tttgattacttaaattcaaaaggacttgatgcaagagttcttgcaaatattaaaattggt
acggttggaagtcagacagctaaagctttaaaggaagtagggctgatttctgattttact
cctgaaatctttgacggtagtcatcttgcactgggaattgcaaagcttgttggagaaaat
gaaaaggttctgatttgtgatgcagcaatagcaagcgacgacattgttaacatttttaaa
agcaataatatcaaatttgacagggttcccttgtactatacaaattatataaatgaaaac
agtgatgaggtcaggaaactgatagtggatggtgaacttaaatacataacttttacaagt
gcatcaacagtagagggatttatagcatctatgaaagatatctctttggaaagtctgaca
gctgtttgcatcggaaatcagacggcggaagcggctaaaaagtataaactgagatatgta
gtagctgaaaaatcaacaattgactcaatgatagataagctattggaaataggaggcggc
attatttatgactaa

DBGET integrated database retrieval system