KEGG   Clostridium sp. BNL1100: Clo1100_0959Help
Entry
Clo1100_0959      CDS       T01708                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
clb  Clostridium sp. BNL1100
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Clo1100_0959
Enzymes [BR:clb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Clo1100_0959
Exosome [BR:clb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clo1100_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1146566..1147543
Genome map
AA seq 325 aa AA seqDB search
MTNRPRRLRTNEVLRKTVRETRLSTDSLIQPLFIIEGKNIKKEISSLPGQYHYSPDMVGE
AIENALKADVKSVLLFGLPEQKDEKGSEAYNENGVLQQGIREIKQRYPQMQVITDICMCE
YTSHGHCGILEGERVDNDRTLPYLEKIALSHARAGADMVAPSDMMDGRIYALRTALDKNG
FTDIPVMSYAVKYASSFYGPFREAAGSAPAFGDRKSYQMDYHNRREAIKEALLDVEEGAD
ILMVKPALSYLDVIKEVREKTQLPLAAYSVSGEYAMIKAAAAQGLIDEYGVMCESTVSIF
RAGADILITYFAGEISQAIKKGDIG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgactaacagaccaagaagattgagaaccaatgaagtgctacgaaaaacagtcagggaa
accagactgtcaactgattcactcattcagcctctttttataatagagggtaaaaatata
aagaaggaaatcagctctctgcccggacagtatcattatagccccgatatggtaggggaa
gcaattgaaaatgcgctaaaagcagatgttaaatcagtactgctttttggactcccggag
caaaaggatgaaaaaggctctgaagcatacaatgaaaacggagtattgcagcaggggata
cgtgaaataaagcagaggtatccccagatgcaggtaataacggatatttgcatgtgtgaa
tacacatctcacggtcactgcggaattttggagggcgagagggtcgataatgatagaaca
ctaccctatcttgaaaagatagctttgtcccatgcaagggcaggagcggacatggtagct
ccgtcggatatgatggacggcaggatatatgcacttagaacggctctggacaagaacgga
tttacagacattcctgtcatgtcatatgccgtaaaatatgcctcgtcattttacgggcca
ttccgtgaggctgcaggctcggcgcctgcattcggagaccgcaaaagctatcagatggat
tatcataacagacgtgaagctataaaggaagcacttcttgatgttgaagaaggtgcggat
atattgatggttaagcctgcactatcgtatctggatgttataaaggaagtcagggaaaaa
actcagttgcctctggcagcctacagtgtaagcggtgaatatgccatgattaaggctgcc
gctgctcaaggactgattgatgaatacggtgtaatgtgtgaaagtacagtcagcattttc
agggccggtgcagatatacttataacctattttgccggagaaatttcccaagcaattaag
aaaggggatataggatga

DBGET integrated database retrieval system