KEGG   Clostridium sp. BNL1100: Clo1100_0970Help
Entry
Clo1100_0970      CDS       T01708                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
clb  Clostridium sp. BNL1100
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:clb00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1158417..1159205
Genome map
AA seq 262 aa AA seqDB search
MVETKYLTDEEAAHAIVEVGKRMYLKGFVASNDGNISIKTGENEILTTPTGVSKGYMTPE
MLVKVDLKGQVISGNTKPSSELKMHLRVYSENPEVMAVTHAHPPVATSFAIAGIELDRAI
LPEAVVNLGTVPIAPYATPGSQAVPDSIAPYCREFNAVLLANHGAVTWGKDVFEAYHRLE
SLEYYATVLMYTGNIIGKANELSSKQISQLVEIRRKLGINTGGTPKGKDMEYNTGDNLPD
EFLIRDIVEQVTSTVLKNYKSK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaactaaatatcttactgatgaggaagccgcacatgccatagttgaagttgga
aagagaatgtatttaaagggctttgtagcttctaatgacggtaacataagcattaagacc
ggcgaaaatgaaatcttgacaactcctacaggtgtttccaaaggatacatgactccagaa
atgctggtgaaagtggatttgaagggacaggttatatccggcaacacaaaaccctcatca
gaattgaaaatgcacctgcgagtatatagtgaaaatcctgaagtaatggctgtaacccac
gcacatcctccggtagcaacttcctttgcaattgcagggattgaactggacagggctatt
ttgcctgaagcagtagtaaatttggggactgttcccatagctccctatgctaccccgggc
agtcaggctgttccagactcaatagcaccctattgccgggagttcaatgcggtacttctt
gcaaaccatggagctgtaacgtggggcaaggatgtattcgaggcgtatcaccgccttgag
tcgctggagtactatgccactgtattaatgtacaccggaaatataatcggaaaagccaat
gaacttagttccaagcagatttcacagttggttgaaatccgccggaaacttggaattaat
acaggtggaacaccgaaaggtaaggatatggaatacaatacaggtgataatttacctgat
gaatttttaatccgtgatattgttgaacaggtaacaagtactgtgctaaagaattataaa
agcaaataa

DBGET integrated database retrieval system