KEGG   Clostridium sp. BNL1100: Clo1100_0991Help
Entry
Clo1100_0991      CDS       T01708                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
clb  Clostridium sp. BNL1100
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:clb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:clb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1181529..1182014
Genome map
AA seq 161 aa AA seqDB search
MISMIWAMGQNNALGCKNRMPWYIPADFSYFKKITMGKTVIMGRKTFESLGKPLPGRKNI
VITRETGYSPEGCTTVNSIQKAMDYTGEEEVFIIGGAEIYKEFLPIADRLYLTLIEKEFE
ADTFFPEIDYSQWKQVSCENGIKDEKNPYKYKWLIYERIKQ
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaatgatatgggctatgggtcagaacaatgcccttggttgtaaaaacagaatg
ccttggtatataccggctgatttttcatacttcaaaaaaattactatgggaaaaacggtc
attatggggagaaaaacctttgaatctctcggtaaacccctgccgggccgaaaaaacata
gtaattacaagggagacaggctatagccctgagggctgtaccacggttaattcaatacaa
aaagctatggattatacaggggaagaggaagtctttataattgggggagcggaaatatac
aaagaatttctccctattgcagacagactgtatctaactctgatagaaaaagagtttgaa
gcggacacttttttcccggaaatcgactatagccaatggaaacaggtatcatgcgagaat
ggtatcaaggatgaaaaaaatccgtataaatataaatggctgatatatgaaagaataaaa
caatag

DBGET integrated database retrieval system