KEGG   Clostridium sp. BNL1100: Clo1100_1011Help
Entry
Clo1100_1011      CDS       T01708                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
clb  Clostridium sp. BNL1100
Pathway
clb00790  Folate biosynthesis
clb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Clo1100_1011
Enzymes [BR:clb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Clo1100_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI Cauli_DNA-bind
Motif
Other DBs
NCBI-ProteinID: AEY65265
UniProt: H2JDT6
Position
1198161..1198748
Genome map
AA seq 195 aa AA seqDB search
MSIDRKKVEEHIRGLLIALGEDPDREGLKDTPSRVARMYEEIFEGISYTNDEIAEMYNKT
FEDDLVIPKDNKEMVLVKDIDIFSYCEHHMALMYNMKVAVAYVPNGKILGLSKIARIADM
VGKRLQLQERIGSDIAEIMQKITDSEDVAVIIEGQHACMTARGIKNTGSRTTTTTFRGNF
NTDTNLTKRLMILYK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagataggaaaaaagttgaagagcatatcagaggtttactgattgctttagga
gaggaccccgacagagagggacttaaagatacaccctcacgtgttgctcgtatgtacgag
gagatttttgaaggaatcagctatacaaatgacgagattgctgaaatgtataacaaaacc
tttgaagatgatctggtgatacctaaagacaacaaagaaatggtattggttaaggatata
gatattttcagttattgcgagcatcatatggcacttatgtacaatatgaaagttgcagtt
gcttatgtacctaacggcaaaatactgggccttagcaaaatagccagaatagccgacatg
gtcggaaaacgtctacagctgcaggaaagaataggttctgacatagctgaaattatgcaa
aagattactgattcagaggacgttgcggtaattattgaaggacagcacgcttgtatgact
gccagaggcattaaaaatacaggatctcggactacaactactacatttcgaggaaatttc
aacacagatacaaatcttacaaaaagattgatgatactatataagtaa

DBGET integrated database retrieval system