KEGG   Clostridium sp. BNL1100: Clo1100_1011Help
Entry
Clo1100_1011      CDS       T01708                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
clb  Clostridium sp. BNL1100
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Clo1100_1011
Enzymes [BR:clb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Clo1100_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1198161..1198748
Genome map
AA seq 195 aa AA seqDB search
MSIDRKKVEEHIRGLLIALGEDPDREGLKDTPSRVARMYEEIFEGISYTNDEIAEMYNKT
FEDDLVIPKDNKEMVLVKDIDIFSYCEHHMALMYNMKVAVAYVPNGKILGLSKIARIADM
VGKRLQLQERIGSDIAEIMQKITDSEDVAVIIEGQHACMTARGIKNTGSRTTTTTFRGNF
NTDTNLTKRLMILYK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagataggaaaaaagttgaagagcatatcagaggtttactgattgctttagga
gaggaccccgacagagagggacttaaagatacaccctcacgtgttgctcgtatgtacgag
gagatttttgaaggaatcagctatacaaatgacgagattgctgaaatgtataacaaaacc
tttgaagatgatctggtgatacctaaagacaacaaagaaatggtattggttaaggatata
gatattttcagttattgcgagcatcatatggcacttatgtacaatatgaaagttgcagtt
gcttatgtacctaacggcaaaatactgggccttagcaaaatagccagaatagccgacatg
gtcggaaaacgtctacagctgcaggaaagaataggttctgacatagctgaaattatgcaa
aagattactgattcagaggacgttgcggtaattattgaaggacagcacgcttgtatgact
gccagaggcattaaaaatacaggatctcggactacaactactacatttcgaggaaatttc
aacacagatacaaatcttacaaaaagattgatgatactatataagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system