KEGG   Clostridium sp. BNL1100: Clo1100_1015Help
Entry
Clo1100_1015      CDS       T01708                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
clb  Clostridium sp. BNL1100
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:clb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1200435..1200932
Genome map
AA seq 165 aa AA seqDB search
MNVPEANSMCDNVVTAYIGLGSNIGDREYQLNRAVELLKLAEKVQVTAVSSYYNTAPVGY
EQQPDFLNAVVEIRTYLSARELLTVCSGIEKELKRERIIHWGPRTIDLDILLYGSDIINE
TDLVIPHPRMHERRFVLEPLNEIAPFVMHPVFNKNINEIFHDNFL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgtaccagaggcgaattcaatgtgtgataatgtagtcactgcatatatagggtta
ggttcaaatataggggatagggaataccagttgaaccgggcagttgaacttcttaaactg
gctgaaaaagttcaagttacggcggtgtcctcttattataatactgccccggtaggatat
gaacagcagccggattttttgaatgctgtggttgaaataaggacatacttgtcagccaga
gaacttctgacagtgtgttcaggaatagaaaaagaactcaaaagagagagaataatacac
tgggggccaaggaccattgatcttgatatactgctctacggaagcgatataatcaatgaa
actgatttggtgattcctcacccaaggatgcatgaacggagatttgtgctggagccttta
aatgaaattgcaccttttgtaatgcatccggtttttaataaaaatataaatgagatattt
catgataactttctgtaa

DBGET integrated database retrieval system