KEGG   Clostridium sp. BNL1100: Clo1100_1030Help
Entry
Clo1100_1030      CDS       T01708                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
clb  Clostridium sp. BNL1100
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:clb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Clo1100_1030
Enzymes [BR:clb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Clo1100_1030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1214410..1215015
Genome map
AA seq 201 aa AA seqDB search
MFAYIKGTVEVKNNDSIIVETGGIGYRIFTALSTINNMGQPGTPVKIYTHYYVREDIAAL
YGFGTVEELAMFEMLLAVSGVGPKAAISLISTLSPSRFALAVVSQDTKSLTKAPGIGMKM
AQRIILELKDKISKEQLTASIPAAGPENSWAPGDSVLSEAVSALMVLGYGSVEASSIISG
IYEEGMSVEDLIKKALKSLSR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcatacataaaaggaacagtggaagtaaaaaacaacgacagtataatagtagaa
accggtggaatcgggtacaggatatttaccgcactttctacaataaataacatgggacag
ccaggtacaccagtaaagatttatactcattattatgtcagagaagatattgcagccctc
tacggcttcggtacagtggaagaactggctatgtttgagatgcttctggcagtttcaggg
gttgggccaaaggccgcaatatccctgatttcaacgctgtcgccatcaagatttgcattg
gctgttgtctctcaggatacaaagtcactgacaaaagccccgggtataggaatgaaaatg
gctcagcgaattatacttgagctaaaggacaaaatatcaaaggaacagcttacagcttct
attccggcagctggtcccgaaaacagctgggctcccggagattctgtcctgtcggaggct
gttagtgctttgatggttttgggatacggctcggtagaagcatcaagcattataagcggt
atttatgaagaaggaatgagtgtagaggatttaataaagaaggcgctcaaatccctttca
agatag

DBGET integrated database retrieval system