KEGG   Clostridium sp. BNL1100: Clo1100_1225Help
Entry
Clo1100_1225      CDS       T01708                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
clb00260  Glycine, serine and threonine metabolism
clb00750  Vitamin B6 metabolism
clb01100  Metabolic pathways
clb01110  Biosynthesis of secondary metabolites
clb01120  Microbial metabolism in diverse environments
clb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clo1100_1225
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Clo1100_1225
Enzymes [BR:clb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Clo1100_1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP 7TM_GPCR_Srj
Motif
Other DBs
NCBI-ProteinID: AEY65473
UniProt: H2JF93
Position
1413916..1415439
Genome map
AA seq 507 aa AA seqDB search
MLYRSTRGSCRSVSAAEAIKRGIAADGGLFVPEKTVQFNLEQIALMSEMSYQERAVKILE
GYLDDYTFEELSECVNKAYTAEKFESNDIAPLHKLYDSVNILELWHGPTSAFKDMALQIL
PHFLVKALKKTGEKEEIVILVATSGDTGKAALEGFKDVKGTKIIVFFPSEGVSQVQKMQM
VTQEGGNVHAIAVNGNFDDAQNGVKRIFGDEDVSVLMEENGYKFSSANSINWGRLAPQIV
YYFSAYADMIKKGEIKAGEKINFVVPTGNFGNILAAYYAMQMGLPVNKLICASNDNNVLT
DFINTGEYNKNRDFKKTLSPSMDILISSNLERLLYLITGDNAEKVCEWMNKLKNEGSYTV
DQDTKKKIQNIFWAGYSNDSDTLKTIESVYQETGYVVDTHTAVAVDVYDKYVISTSDVTK
AVIVSTASPFKFNESVVKAIAGEETIKGKTEFELLSVLSEKSGLRIPAPLKELDKKPVLH
KGFCEPINMIDKVKDALNIQENIKTEK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttatatcgaagcacaagaggaagttgcagaagtgtgagtgcagctgaagctataaag
agaggtattgcagcagacggaggtctgtttgtacctgaaaagacagttcagtttaatctt
gaacaaatagctcttatgagtgaaatgagttatcaggaaagagccgttaagatactggaa
ggttatttggatgactatactttcgaggaactttcagagtgtgtaaacaaggcttatacc
gcagagaaatttgaaagtaatgatattgctcctttgcataagctttatgattcggtaaat
atactggaactgtggcatgggcctacaagtgcattcaaagatatggctctgcaaatactt
ccacattttcttgttaaagcacttaagaaaactggggaaaaagaagagatagttattctg
gtcgcaacttcaggagatacaggaaaagctgctcttgaaggattcaaggatgtaaaaggg
acaaagattatagtatttttcccaagcgaaggcgtcagccaggtacagaaaatgcaaatg
gttacccaggagggtggcaatgtacacgctatagctgtaaacggcaattttgatgatgct
cagaatggtgttaaaagaatattcggtgatgaggatgtatcggtattaatggaagaaaac
ggatacaagttttcatcagcaaattctataaactggggcagactcgcaccacaaatcgtt
tattatttttcagcatatgctgatatgataaagaaaggtgaaattaaagcaggggaaaag
attaattttgttgttcctacaggtaatttcggtaatattctggccgcatattatgcaatg
cagatgggcttacctgttaacaagctaatttgtgcttcaaatgacaataatgtgctgaca
gattttattaatacaggcgaatacaataaaaacagagatttcaaaaagactttgtctcca
tcaatggatattctcatatcaagcaatttggaacgccttttgtacctgataaccggtgat
aatgccgaaaaggtttgcgaatggatgaacaagcttaaaaatgaaggttcatatactgta
gatcaggataccaaaaagaaaatccagaatatattctgggcaggttattcaaatgacagt
gatactttaaaaacgattgaaagtgtttatcaggagacaggatacgtagttgacacacat
actgcggttgcagtggatgtatatgacaaatatgttatctccacaagcgatgttacaaaa
gcggttattgtttctacagccagcccgttcaagttcaatgagagtgttgtaaaagcaatt
gcaggagaagagacgattaaaggaaagactgagttcgagttgctgtctgtactgtctgaa
aagtcaggccttagaattcctgctccattaaaggaattggataaaaagcctgttcttcac
aaaggtttttgcgaacctataaacatgattgataaggttaaggatgcattaaatattcaa
gaaaatatcaaaacagaaaaataa

DBGET integrated database retrieval system