KEGG   Clostridium sp. BNL1100: Clo1100_1225Help
Entry
Clo1100_1225      CDS       T01708                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clo1100_1225
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clo1100_1225
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Clo1100_1225
Enzymes [BR:clb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Clo1100_1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1413916..1415439
Genome map
AA seq 507 aa AA seqDB search
MLYRSTRGSCRSVSAAEAIKRGIAADGGLFVPEKTVQFNLEQIALMSEMSYQERAVKILE
GYLDDYTFEELSECVNKAYTAEKFESNDIAPLHKLYDSVNILELWHGPTSAFKDMALQIL
PHFLVKALKKTGEKEEIVILVATSGDTGKAALEGFKDVKGTKIIVFFPSEGVSQVQKMQM
VTQEGGNVHAIAVNGNFDDAQNGVKRIFGDEDVSVLMEENGYKFSSANSINWGRLAPQIV
YYFSAYADMIKKGEIKAGEKINFVVPTGNFGNILAAYYAMQMGLPVNKLICASNDNNVLT
DFINTGEYNKNRDFKKTLSPSMDILISSNLERLLYLITGDNAEKVCEWMNKLKNEGSYTV
DQDTKKKIQNIFWAGYSNDSDTLKTIESVYQETGYVVDTHTAVAVDVYDKYVISTSDVTK
AVIVSTASPFKFNESVVKAIAGEETIKGKTEFELLSVLSEKSGLRIPAPLKELDKKPVLH
KGFCEPINMIDKVKDALNIQENIKTEK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttatatcgaagcacaagaggaagttgcagaagtgtgagtgcagctgaagctataaag
agaggtattgcagcagacggaggtctgtttgtacctgaaaagacagttcagtttaatctt
gaacaaatagctcttatgagtgaaatgagttatcaggaaagagccgttaagatactggaa
ggttatttggatgactatactttcgaggaactttcagagtgtgtaaacaaggcttatacc
gcagagaaatttgaaagtaatgatattgctcctttgcataagctttatgattcggtaaat
atactggaactgtggcatgggcctacaagtgcattcaaagatatggctctgcaaatactt
ccacattttcttgttaaagcacttaagaaaactggggaaaaagaagagatagttattctg
gtcgcaacttcaggagatacaggaaaagctgctcttgaaggattcaaggatgtaaaaggg
acaaagattatagtatttttcccaagcgaaggcgtcagccaggtacagaaaatgcaaatg
gttacccaggagggtggcaatgtacacgctatagctgtaaacggcaattttgatgatgct
cagaatggtgttaaaagaatattcggtgatgaggatgtatcggtattaatggaagaaaac
ggatacaagttttcatcagcaaattctataaactggggcagactcgcaccacaaatcgtt
tattatttttcagcatatgctgatatgataaagaaaggtgaaattaaagcaggggaaaag
attaattttgttgttcctacaggtaatttcggtaatattctggccgcatattatgcaatg
cagatgggcttacctgttaacaagctaatttgtgcttcaaatgacaataatgtgctgaca
gattttattaatacaggcgaatacaataaaaacagagatttcaaaaagactttgtctcca
tcaatggatattctcatatcaagcaatttggaacgccttttgtacctgataaccggtgat
aatgccgaaaaggtttgcgaatggatgaacaagcttaaaaatgaaggttcatatactgta
gatcaggataccaaaaagaaaatccagaatatattctgggcaggttattcaaatgacagt
gatactttaaaaacgattgaaagtgtttatcaggagacaggatacgtagttgacacacat
actgcggttgcagtggatgtatatgacaaatatgttatctccacaagcgatgttacaaaa
gcggttattgtttctacagccagcccgttcaagttcaatgagagtgttgtaaaagcaatt
gcaggagaagagacgattaaaggaaagactgagttcgagttgctgtctgtactgtctgaa
aagtcaggccttagaattcctgctccattaaaggaattggataaaaagcctgttcttcac
aaaggtttttgcgaacctataaacatgattgataaggttaaggatgcattaaatattcaa
gaaaatatcaaaacagaaaaataa

DBGET integrated database retrieval system