KEGG   Clostridium sp. BNL1100: Clo1100_1447Help
Entry
Clo1100_1447      CDS       T01708                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
clb  Clostridium sp. BNL1100
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:clb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1685456..1686601
Genome map
AA seq 381 aa AA seqDB search
MAKIISIIGSTGSIGRQTLEAAKNLGVKVAALSANSNIELLEKQVREFKPDIVSVGNNEL
AKEMLYRLKDTGVEVLWGQDGMKRVVEHSETDTVVTSVVGTAGLIPTMHAIRHKKNIALA
NKETLVTAGQLVMEEAKRNNVNIFPVDSEHSAIYQCLLGNKDKQVEKIIITASGGPFRGK
KIEELKNITPAKALKHPNWSMGNKITIDSATLMNKGLEVIEAKWLFQRDLDSIQVLVHPQ
SIIHSMVQYVDGSVMAQLGSPDMRIPIQLALTYPDRCQNDFNKLDFLKCPPLTFEEPDID
TFKCLRLAYMSLEIGGTMPATMNAANEIAVAAFLDNRIGFTEIAETIEQVMQRHNVNICP
CMDDILEVDCWARETAKQLII
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaattatatccataatcggttcaacaggttccataggcaggcaaaccttagag
gcggcaaaaaaccttggggttaaagttgctgcattatcagccaattcaaatatagagctt
ttggaaaagcaggtacgtgaattcaagcctgatattgtttcggtaggaaataatgagttg
gcaaaagaaatgttatatagattgaaggataccggagtagaagtgctatgggggcaggac
ggtatgaaaagagttgtggagcactctgaaaccgataccgtagttacctctgtagtggga
acagccggtttgatacccacaatgcatgctatcaggcataaaaaaaatatagcacttgca
aacaaggagacacttgtaactgcagggcagctggtgatggaagaggcaaaaaggaataat
gtaaatatattccccgttgacagtgaacactcggctatataccaatgtcttttaggaaat
aaagacaagcaggtagaaaaaataataataactgcttcgggtggcccttttaggggtaag
aaaatagaagagcttaaaaatataacacctgcaaaggcattaaaacatcccaattggagt
atgggaaacaagataacaattgattccgcaactcttatgaacaaaggacttgaggtaatc
gaggcaaagtggctttttcagagggatttggacagtattcaggttttggtgcatcctcaa
agcataatacattcaatggtacaatatgtggatggatcggttatggcgcaacttggttcg
cctgacatgaggataccgatacagttggcattaacctacccggacagatgccaaaatgat
tttaacaagcttgattttcttaaatgtcctcctttgacctttgaggaaccagacatagat
acttttaaatgtcttcgtcttgcatatatgtcattggagataggtgggacaatgcctgcg
actatgaatgctgcaaatgagattgcagttgcagcatttctggataatcgtataggcttt
actgaaattgcggaaacaatagaacaagtaatgcaaagacataatgtgaatatttgtcct
tgcatggatgatatactagaagtagactgttgggcaagggaaacagcaaaacaacttata
atttaa

DBGET integrated database retrieval system