KEGG   Clostridium sp. BNL1100: Clo1100_1477Help
Entry
Clo1100_1477      CDS       T01708                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
clb  Clostridium sp. BNL1100
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:clb00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:clb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1722155..1723618
Genome map
AA seq 487 aa AA seqDB search
MQLKELVRDLNIKEINGSLDVEVDSIAYDSRKTKQGSLFVCIEGTVVDGHKYINDAIENG
TKAFLVQKHVEVPEGITTVETDDTRFGLAAVCDAFFDHPSSKLNLIGITGTKGKTTTTYM
VKSILEAAGHNMGLIGTVANLIGNQVLYTSRTTPESYDLQSLFNDMVEKKVDSAVMEVSS
QGLELHRVAKCDFDIGVFTNFSRDHIGPKEHATLEEYFNAKAKLFKMCRKAVINIDSEHG
RKMAELAECNVLTYGLSNKADIWASDIVKKTGHTYFKLNSPWGSIDIETDLQGEFNIYNA
LAAIGSCCLIPGITLEHVKTGLTKVTVPGRMESVKTGGNYSVLIDYAHTPDSLEQVLKTV
KEFAHGRVVSLFGCGGDRDKGKRPAMGEISGNIANFTIITSDNPRTENPEQIIEDIEAGI
KNTNGKYIKITDRRQAIKFALENAQDGDIIILAGKGHETYQQFAEKTIHFDEREVVNELL
VELGRSE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
ttgcaactaaaagagcttgtaagggatttaaatatcaaagaaattaatggaagtcttgat
gtggaagttgacagtatagcatatgattccagaaaaacaaaacagggcagtctttttgtt
tgtattgaaggaactgtggttgacggacacaagtacataaatgatgctatagaaaacgga
accaaggcatttctcgttcagaagcatgtagaggtacctgaaggaattacaacagttgaa
acagatgatacaaggttcggacttgcggcagtatgtgatgcgttttttgaccatccgtct
tcaaaattgaaccttataggcattacaggaacaaaaggtaaaactacaactacttatatg
gttaaatctatcctggaggctgcagggcataatatgggccttataggcaccgttgccaat
ctcataggaaatcaggtgctgtatacctccagaacaactccggaatcatatgatttacag
agccttttcaatgatatggttgaaaaaaaggtagacagtgcggtaatggaggtatcctct
cagggattggaacttcacagggtagcaaaatgtgattttgatatcggagtatttacaaac
ttttcaagagaccatatcgggccaaaggaacatgcaacacttgaagaatatttcaatgca
aaagcaaagctgtttaaaatgtgccgtaaagcagttattaatatagacagtgaacatggc
agaaaaatggcagaactggctgaatgtaatgtgctaacatacggcttgagcaataaggcg
gatatatgggcgtctgatatagtaaagaaaacaggacacacatactttaaacttaattct
ccatggggcagtattgacattgaaactgatctccagggtgagttcaacatatacaatgca
ttggcggccatcggttcttgttgcttgataccgggtattacattggagcatgtaaaaaca
ggactgacaaaggttacggttccgggcagaatggagtctgtaaaaacgggtggtaattat
tctgttctgatagattacgcacatacccccgacagccttgaacaggtacttaaaacagta
aaagagtttgcacatggaagggttgtcagtctttttggttgcggaggggacagagataag
ggaaagagacctgcaatgggtgaaatttcaggaaatatagctaattttacaattataacc
tctgataatcctagaactgaaaaccccgaacaaataattgaagacattgaggcaggcatt
aaaaatacaaatggaaaatatattaaaataactgatagaaggcaggcaataaaatttgca
cttgaaaatgctcaggatggagatataattattttggcaggtaagggacatgagacctac
cagcaatttgccgaaaaaacaatacactttgatgaacgtgaggtagtaaatgagctgctg
gtagaactcggaaggagtgagtag

DBGET integrated database retrieval system