KEGG   Clostridium sp. BNL1100: Clo1100_1491Help
Entry
Clo1100_1491      CDS       T01708                                 

Definition
acyl-CoA synthetase/AMP-acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1100_1491
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1100_1491
   00620 Pyruvate metabolism
    Clo1100_1491
   00640 Propanoate metabolism
    Clo1100_1491
  Energy metabolism
   00680 Methane metabolism
    Clo1100_1491
Enzymes [BR:clb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Clo1100_1491
Lipid biosynthesis proteins [BR:clb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Clo1100_1491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1741621..1743279)
Genome map
AA seq 552 aa AA seqDB search
MLEKYLSRVDFTSYEDFYENFKINVPENFNFAYDVVDEYARTTPDKVAIVWCDKSGAEET
FTFGQLKEYSDKTANFFKSLGIKRGDPVMLILKRRYEFWFCILALHKLGAVTIPATHLLT
SKDIVYRANAADIKMIVCVNEPEVVKHIEDSASKTPTVKYKALINGTKDGWLDFSSGIEE
ASSEFQRPQGDSGSHNSDISLLYFTSGTTGMPKMVQHDYEYPLGHILTARYWQNVSEGGL
HLTVADTGWAKAVWGKIYGQWLSGCAVFVYDFDKFVPKELLEVISKHHVTSFCAPPTIYR
FFIKEDLSKFDLSSLKYCTVAGEPLNPEVYSQFYKATGIKLMEAFGQTELTVTVGTFPWM
EPKPGSMGKPSPGYDIDLLDDNGNSCQDGEEGQIVVRTTKRKPAGMFGGYYRDEALTKSV
WHDGIYYTGDMAWRDEDGYLWFVGRADDVIKSSGYRIGPFEVESALLEHPAVLECAITAV
PDPIRGQIVKATVILAKNYTPSDELVKELQDHVKRVTAPYKYPRIIEFVNELPKTISGKI
RRVEIRQTDKDK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaaaatacttatctcgggtagactttacatcttatgaggatttttacgagaac
tttaaaataaatgtacctgagaactttaattttgcatatgacgttgttgatgaatatgca
aggacaacaccagataaggtagcaatagtatggtgtgataaatcgggagccgaagaaacg
ttcaccttcggtcagttaaaagagtatagcgataagacagctaacttttttaagtcattg
ggtattaaaaggggcgaccctgtaatgcttatactaaaaagacgctatgagttctggttc
tgtattctggctttgcacaagctgggtgccgttacaattccggctactcatctgctcact
tcaaaggatatagtttatagagctaatgcagcagatataaaaatgatcgtttgtgttaac
gaaccagaggttgtaaagcatatagaagattccgcaagtaaaacaccaaccgtaaaatat
aaggcattgattaatggtaccaaggatggctggttggatttttcatccggcattgaagaa
gcttccagtgaatttcaaaggcctcagggagattcaggctctcacaacagcgacatatca
ttgctatactttacgtcgggtactacaggtatgccaaagatggttcagcacgattacgaa
tatcctttgggacatatccttacagccagatactggcagaatgtttctgaaggcggcctg
catctgactgttgccgatacaggctgggctaaagccgtatggggcaaaatatatggccaa
tggttatcagggtgtgccgtatttgtatatgactttgataagtttgttccaaaggaactt
cttgaggttatttcaaagcaccatgttacttctttttgtgctcctcctacaatttataga
ttttttataaaggaagatctctccaagtttgatttaagcagtctgaaatattgcactgtt
gcaggagaacctcttaatcccgaggtatacagccaattttacaaggctactggcataaag
ctaatggaagccttcggtcagacagaattgactgttacagtaggtactttcccttggatg
gagccaaagccggggtcaatgggtaagccgtctccgggatacgatatagaccttcttgat
gacaacggaaattcatgtcaggatggtgaagaaggccagattgttgttaggactaccaaa
aggaaacctgccggtatgttcggtggctactacagagacgaggcacttactaagagcgta
tggcatgatggtatttattatacaggcgatatggcgtggcgtgatgaagacggctatctc
tggtttgtgggcagagctgatgatgtaattaaaagctcaggttacagaattgggcctttt
gaggttgaaagtgctttgcttgaacatcctgcagttttggaatgtgccataactgctgtt
cctgaccctatcagaggtcagattgttaaagctacggttatacttgctaagaactatact
ccaagtgacgaactggttaaggaacttcaggatcatgtaaagagggttacggcaccttac
aaatatccaagaatcattgagtttgtaaatgagcttcctaaaaccataagtggaaaaata
agacgtgttgaaataagacagacagataaagataaatag

DBGET integrated database retrieval system