KEGG   Clostridium sp. BNL1100: Clo1100_1491Help
Entry
Clo1100_1491      CDS       T01708                                 

Definition
(GenBank) acyl-CoA synthetase/AMP-acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
clb00010  Glycolysis / Gluconeogenesis
clb00620  Pyruvate metabolism
clb00640  Propanoate metabolism
clb00680  Methane metabolism
clb01100  Metabolic pathways
clb01110  Biosynthesis of secondary metabolites
clb01120  Microbial metabolism in diverse environments
clb01130  Biosynthesis of antibiotics
clb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1100_1491
   00620 Pyruvate metabolism
    Clo1100_1491
   00640 Propanoate metabolism
    Clo1100_1491
  Energy metabolism
   00680 Methane metabolism
    Clo1100_1491
Enzymes [BR:clb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Clo1100_1491
Lipid biosynthesis proteins [BR:clb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Clo1100_1491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEY65723
UniProt: H2JH71
Position
complement(1741621..1743279)
Genome map
AA seq 552 aa AA seqDB search
MLEKYLSRVDFTSYEDFYENFKINVPENFNFAYDVVDEYARTTPDKVAIVWCDKSGAEET
FTFGQLKEYSDKTANFFKSLGIKRGDPVMLILKRRYEFWFCILALHKLGAVTIPATHLLT
SKDIVYRANAADIKMIVCVNEPEVVKHIEDSASKTPTVKYKALINGTKDGWLDFSSGIEE
ASSEFQRPQGDSGSHNSDISLLYFTSGTTGMPKMVQHDYEYPLGHILTARYWQNVSEGGL
HLTVADTGWAKAVWGKIYGQWLSGCAVFVYDFDKFVPKELLEVISKHHVTSFCAPPTIYR
FFIKEDLSKFDLSSLKYCTVAGEPLNPEVYSQFYKATGIKLMEAFGQTELTVTVGTFPWM
EPKPGSMGKPSPGYDIDLLDDNGNSCQDGEEGQIVVRTTKRKPAGMFGGYYRDEALTKSV
WHDGIYYTGDMAWRDEDGYLWFVGRADDVIKSSGYRIGPFEVESALLEHPAVLECAITAV
PDPIRGQIVKATVILAKNYTPSDELVKELQDHVKRVTAPYKYPRIIEFVNELPKTISGKI
RRVEIRQTDKDK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaaaatacttatctcgggtagactttacatcttatgaggatttttacgagaac
tttaaaataaatgtacctgagaactttaattttgcatatgacgttgttgatgaatatgca
aggacaacaccagataaggtagcaatagtatggtgtgataaatcgggagccgaagaaacg
ttcaccttcggtcagttaaaagagtatagcgataagacagctaacttttttaagtcattg
ggtattaaaaggggcgaccctgtaatgcttatactaaaaagacgctatgagttctggttc
tgtattctggctttgcacaagctgggtgccgttacaattccggctactcatctgctcact
tcaaaggatatagtttatagagctaatgcagcagatataaaaatgatcgtttgtgttaac
gaaccagaggttgtaaagcatatagaagattccgcaagtaaaacaccaaccgtaaaatat
aaggcattgattaatggtaccaaggatggctggttggatttttcatccggcattgaagaa
gcttccagtgaatttcaaaggcctcagggagattcaggctctcacaacagcgacatatca
ttgctatactttacgtcgggtactacaggtatgccaaagatggttcagcacgattacgaa
tatcctttgggacatatccttacagccagatactggcagaatgtttctgaaggcggcctg
catctgactgttgccgatacaggctgggctaaagccgtatggggcaaaatatatggccaa
tggttatcagggtgtgccgtatttgtatatgactttgataagtttgttccaaaggaactt
cttgaggttatttcaaagcaccatgttacttctttttgtgctcctcctacaatttataga
ttttttataaaggaagatctctccaagtttgatttaagcagtctgaaatattgcactgtt
gcaggagaacctcttaatcccgaggtatacagccaattttacaaggctactggcataaag
ctaatggaagccttcggtcagacagaattgactgttacagtaggtactttcccttggatg
gagccaaagccggggtcaatgggtaagccgtctccgggatacgatatagaccttcttgat
gacaacggaaattcatgtcaggatggtgaagaaggccagattgttgttaggactaccaaa
aggaaacctgccggtatgttcggtggctactacagagacgaggcacttactaagagcgta
tggcatgatggtatttattatacaggcgatatggcgtggcgtgatgaagacggctatctc
tggtttgtgggcagagctgatgatgtaattaaaagctcaggttacagaattgggcctttt
gaggttgaaagtgctttgcttgaacatcctgcagttttggaatgtgccataactgctgtt
cctgaccctatcagaggtcagattgttaaagctacggttatacttgctaagaactatact
ccaagtgacgaactggttaaggaacttcaggatcatgtaaagagggttacggcaccttac
aaatatccaagaatcattgagtttgtaaatgagcttcctaaaaccataagtggaaaaata
agacgtgttgaaataagacagacagataaagataaatag

DBGET integrated database retrieval system