KEGG   Clostridium sp. BNL1100: Clo1100_1675Help
Entry
Clo1100_1675      CDS       T01708                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
clb  Clostridium sp. BNL1100
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Clo1100_1675
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Clo1100_1675
Enzymes [BR:clb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Clo1100_1675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1930181..1931122
Genome map
AA seq 313 aa AA seqDB search
MNLKSKDLLGLRDISAEEIEYILNTAKTMKCIVTSNNKKTAHLQGKSIITLFYENSTRTR
LSFELASKYMGASAANISASSSSVQKGETLIDTGKTIDDMGSDIIIMRHPMSGAPHLLAK
NVKSSIINAGDGMNEHPTQALLDMFTIQEKKGTLKGLKVAIIGDILHSRVARSNIWGLTK
MGAEVNVSGPATLMPPEIEKMGVNVFSTVQEAMLDADVVMGLRIQLERQKKGLFPTIREY
ARFFGVDDKRLKLAKEDAIVLHPGPVNRGVELSTSVTDGEQSFINEQVTNGVAVRMALLY
LLTRRGTVNEVTN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgaaatccaaagatttactgggactgagggatatttcggcagaagaaattgag
tatattctaaataccgccaaaacaatgaaatgtattgttacatcaaacaacaaaaaaaca
gcgcatcttcagggaaaatcaatcattacactattctacgaaaacagtacaagaacaaga
ctatcatttgaactggcttccaagtatatgggagccagcgccgcaaatatatccgcatca
agcagcagcgttcaaaagggcgaaacattaatagacacaggaaaaacaattgacgatatg
ggttcggatataataataatgagacatccaatgtccggggcacctcatcttcttgctaaa
aacgtaaaatcctcaataataaatgccggggatggtatgaatgaacatcccacacaggct
ttacttgacatgtttacaatacaggagaaaaagggtacattaaagggcctgaaggtggcc
attataggagacatacttcacagcagagttgccagaagtaatatatgggggctgacaaaa
atgggtgcggaggttaatgtatccgggcctgctacgctgatgccccctgagattgaaaaa
atgggtgtaaatgttttcagtacggttcaggaagcaatgctggatgctgatgttgtcatg
ggtctgagaattcagttggagcgtcagaagaaggggttgttccccacaataagagaatac
gcaaggtttttcggagttgacgataaaaggttaaaacttgccaaggaggatgcaatagtg
cttcatcccggccctgtaaacagaggggttgagctttctacctcagtcactgacggagaa
cagtctttcataaacgaacaggtaactaatggagttgcagtgagaatggcactgctatat
cttttaacaaggaggggaaccgtaaatgaagttactaattaa

DBGET integrated database retrieval system