KEGG   Clostridium sp. BNL1100: Clo1100_1778Help
Entry
Clo1100_1778      CDS       T01708                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
clb  Clostridium sp. BNL1100
Pathway
clb00010  Glycolysis / Gluconeogenesis
clb00052  Galactose metabolism
clb00500  Starch and sucrose metabolism
clb00520  Amino sugar and nucleotide sugar metabolism
clb00521  Streptomycin biosynthesis
clb00524  Neomycin, kanamycin and gentamicin biosynthesis
clb01100  Metabolic pathways
clb01110  Biosynthesis of secondary metabolites
clb01120  Microbial metabolism in diverse environments
clb01130  Biosynthesis of antibiotics
clb01200  Carbon metabolism
Module
clb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
clb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1100_1778
   00052 Galactose metabolism
    Clo1100_1778
   00500 Starch and sucrose metabolism
    Clo1100_1778
   00520 Amino sugar and nucleotide sugar metabolism
    Clo1100_1778
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Clo1100_1778
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Clo1100_1778
Enzymes [BR:clb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Clo1100_1778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEY65988
UniProt: H2JJL4
Position
2052660..2053637
Genome map
AA seq 325 aa AA seqDB search
MKYTIGIELGVKNIVAGILDKNGKLIRRDTVPTNKDREFQEIIKDVCALIRKITADEDIE
IKNIKYIGVGCPGVTDNKRGIVLKNYSLNFTNAHVRNEIQKHINLPVFVENDANCVAIAE
YLLGAAYGTESSLTIKVGVGIGGGIIIDGSIYNGFNFGGTEFGHMVIEYNGRPCSCGRKG
CWEQYVSGSSLINQTKQLAAENPDSILGKMVMNNVAQITELTIFEAAKAGDEKAKKLCSE
FVEYFAEGLTNIVNILMPEVVIIAGPISKLGNAIVNPLVELLKDRIYSKELNLPEFKMAE
MGNAGIVVGAAMLGSFKDEKLDDLV
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatactattggtattgaattgggagtcaaaaatatcgttgcaggtatacttgat
aaaaatggtaaattaattcgcagagatactgtacccacgaataaagacagagaatttcaa
gaaataattaaggatgtttgtgcattaataagaaagataactgcagatgaggatattgaa
ataaaaaatataaaatatataggagtaggatgtcccggggtaaccgataataagaggggc
attgttttaaaaaactactcgctaaatttcacaaatgcccatgtcaggaatgagattcag
aagcacataaaccttcctgtttttgttgaaaatgatgcaaactgtgtagctatagctgaa
tatctgcttggtgccgcatacggtactgaaagttcacttactattaaagtaggagtgggt
atcggcggaggaattattattgacggaagtatatataacggatttaacttcggtgggaca
gagttcggtcatatggttatagagtataacggaaggccgtgcagctgtggcagaaaaggt
tgttgggagcagtatgtgtcgggatcttcacttattaatcaaaccaaacaactggcagca
gaaaatccggattccattttaggaaaaatggttatgaacaatgttgcacagataactgaa
ttaacaatattcgaagctgccaaggcaggtgatgaaaaggccaaaaaactgtgctctgaa
ttcgttgagtattttgctgagggattaacaaacattgtaaatatattaatgcctgaagtt
gtaataatcgcagggcctataagtaagctaggaaatgcgattgtaaacccattggttgag
cttttgaaagacagaatatattcaaaagagcttaatcttccggaatttaaaatggctgaa
atgggtaatgcaggtattgtagtaggtgcggcaatgttagggtcttttaaggacgaaaaa
cttgatgacttggtataa

DBGET integrated database retrieval system