KEGG   Clostridium sp. BNL1100: Clo1100_1847Help
Entry
Clo1100_1847      CDS       T01708                                 

Definition
glycosyl hydrolase family 11,dockerin-like protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
clb  Clostridium sp. BNL1100
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2138405..2139301
Genome map
AA seq 298 aa AA seqDB search
MKKKIMKALTLGLSIACCAFALNVQAATTITENKTGTIDGYDYELWKDNGTTSMTLNGGG
KFSCSWSNINNALFRTGKKYNETQTHQQLGTISLDYACNYQPSGNSYLSVYGWTSSPLVE
YYIIESWGSWRPPGASSKGTITVDGATYDVYETTRVNQPSIKGTATFQQYWSVRTSKRTS
GTISVSEHFKAWEKMGMTMGKMYEVSFVVEGYQSSGRADVTDMTINVGGGTQPIVKGDLN
ADGSINALDFAALKSHLVGATKLSGTALSNADVNGDGQVDALDFAIMKKFILGIITTF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaataatgaaggccctgactttgggcttatcaatcgcatgttgtgccttt
gctttaaacgtacaggcagcaacaaccattactgagaataaaaccggaaccattgacgga
tacgactacgagttgtggaaggataatggtactacaagtatgactttaaatggtggcggt
aagttcagctgctcgtggagtaatatcaataatgcattattccgtacaggtaaaaagtac
aatgagactcagacacatcagcaacttggaaccatctcattggactacgcatgtaactac
cagccatcaggtaattcatacttgtctgtctatggttggacaagcagtcccctggtagag
tattacatcatcgagagctggggcagctggagaccacctggagcttcgtcaaagggaacc
attactgttgatggtgctacatatgacgtttacgagactactcgtgtaaaccaaccatca
attaaaggtactgcaacttttcagcagtattggagtgttaggacatcgaaacgtacaagc
ggaacaatatctgtaagtgaacacttcaaggcatgggaaaagatgggcatgacaatgggt
aagatgtatgaagtttcattcgttgttgagggttaccaaagtagcggcagagctgatgtt
actgatatgacaattaatgttggtggaggaactcaacctatagtaaaaggtgatttaaat
gctgatggaagtattaatgcattagactttgcagcactaaaatcgcatttagtaggagct
acaaaactttcaggaacagctctttctaatgctgacgttaacggagatggtcaagttgac
gctctggattttgcaattatgaaaaagtttatattaggtataataactactttctaa

DBGET integrated database retrieval system