KEGG   Clostridium sp. BNL1100: Clo1100_1851Help
Entry
Clo1100_1851      CDS       T01708                                 

Definition
dockerin-like protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
clb  Clostridium sp. BNL1100
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:clb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2144927..2146864
Genome map
AA seq 645 aa AA seqDB search
MNLISSEKKRKIKAGIACFTISGILATSGGIIPGILNQNVYAASTSPGDYQQDSRIRLNS
IGYLPEAEKKATIAASSGDFIVVNSSGTAVLTGKTTTVYDSDTNEQVSIADFSQVKTEGS
YTLLVPGIGKSVTFKIDPNIYLNPFKTTMLGMYLWRCGTSVSATYNGKVFSHEACHTKDA
YTDYINGQHNIKDGGKGWHDAGDYNKYVVNAGITLGSMFFAWEQFKDQIKDISLTMPESN
NSMPDYLDELKYETDWLLTMQYPDGSGKVSHKLSTKDFGGFVLPERETADRFFTSWGSSA
TADFVAMMAMASRAFRPYDAAYADKCIAAAKVSYTFLKANPGNTKPDQSAFTTGAYDTTD
TDDRLWAAAEMWETTGDSSYLADFEASANTFTKKIDVDFDWGNVNNLGMFTYLLSEKSGK
NTTLYNTIKNALISVADSIVATADGHGYGRPLGATYYWGCNGTVARQTMILNIANKLSPK
SEYVNTSLDALNFLFGRNYYDRSFVTGLGLNPPMYPHDRRSGGDSLTDPWPGYLVGGGWP
GAKDWKDNQESYQTNEIAINWNGALIYALAASLDISDTPDALLGDINMDAKVDAIDYALL
KQYILGLSNLSVDALRSADVNHDNTVDALDLSILKQYLLGKITSL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaataagttctgaaaaaaagcgtaaaataaaagcagggattgcatgctttacc
ataagcggaattctcgcaacatccgggggcatcattcctggaattttaaatcaaaatgtg
tatgcggcaagtacgtctcccggagattatcagcaggattcccgcatacgtctcaactct
atcgggtatcttcccgaagccgagaaaaaagcaacaatcgcagcttcatccggtgatttt
attgtagtaaattcaagcggaacagctgttttaacgggtaaaactactacagtttatgac
tctgataccaatgagcaggttagtattgctgatttttcacaggtaaagacggaaggaagc
tacaccttgcttgtaccgggaataggaaagagtgtaacctttaaaatcgatccgaatatt
tacttaaatccatttaaaacaacaatgcttggaatgtatctgtggcgctgcggaacgtca
gtttccgcaacatataacggcaaggtattctctcatgaggcttgtcataccaaagacgca
tatactgactatattaatggacagcataacataaaagatggcggaaaaggctggcacgat
gccggggattacaataaatatgttgttaatgccggtattacactaggttccatgtttttc
gcatgggagcagtttaaagaccagataaaagacatttcattaacaatgcctgagagtaat
aactcaatgccggattatttagatgaactaaaatatgaaacggattggcttttaaccatg
caatatcccgatggaagcgggaaagtaagccataagctttctacaaaagactttggtggg
tttgtgctacctgaaagagaaactgccgacaggtttttcacttcatggggaagttctgca
acagcagattttgttgctatgatggcaatggcctcaagagcattcaggccgtatgatgcg
gcatatgccgacaaatgcattgctgccgcaaaagtcagttatacatttctaaaagcaaat
cctggaaatacaaaacctgaccagagtgcttttaccacaggtgcttatgataccacagat
acggatgacagactttgggcggctgcggaaatgtgggaaactactggagacagcagctac
ctggcagattttgaagcaagcgcaaatacctttactaagaaaattgacgttgatttcgat
tggggaaatgtaaataatcttggaatgtttacatacctgttatctgaaaagagcggaaaa
aacacaacactctataatacaattaagaatgcattgatttcagtagcagacagtatcgtt
gctactgctgacggacacggctatggaaggccattgggagctacctattactggggctgc
aatggtaccgtggcacgtcaaaccatgattctaaatattgcaaataaattatcaccaaag
tctgagtatgttaatacatctcttgatgcattgaacttcctgttcggcagaaactattat
gatcgttcctttgttacagggctgggactaaaccctccgatgtacccacatgacagacgt
tcaggcggtgattccttgactgatccctggcccggatatttggtcggaggaggttggccg
ggagccaaagattggaaggataatcaggagagttatcagaccaatgagattgcaataaat
tggaatggtgcattgatttatgctctggctgcttctcttgacatatctgatactcctgat
gcactattaggagatataaatatggatgcaaaagtggatgctattgattatgctttgctg
aaacagtatatattgggtttgagtaatttgtccgtagatgcattgagatctgctgacgta
aaccatgataatacagtagacgcattagatttatcaattttaaaacagtatttgttaggc
aagattacaagcttataa

DBGET integrated database retrieval system