KEGG   Clostridium sp. BNL1100: Clo1100_1882Help
Entry
Clo1100_1882      CDS       T01708                                 

Definition
cysteine protease
Organism
clb  Clostridium sp. BNL1100
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2179632..2180408
Genome map
AA seq 258 aa AA seqDB search
MNYKYSYNKDKIDYRDLLFSSSVSPHPEIILPKLIDLREKCPPVYNQGNLGSCTANAGCT
CRAMLLQDKQIQLSRMFLYYEERKLEGKTSKDDGASLRDTCKSIYKKGVCEEKYMPYNPE
NYMLPPSKLAKINARQYKIIAYKSLSSLDEIKQNLAFRQQPVLLGMNVYESFESDAVTKT
GIMPMPRKNEKKLGAHAVLIVGYKDIVKNHGMSGRNKHQQGYLFVRNSWGDKWGDKGYFY
MPFDYVIPDYTFDYWIME
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaatattcttataataaagataagattgattatagagatttacttttttct
agttcagtatcgccacatcctgaaataatactacctaaattaatagacttaagagagaaa
tgtccacctgtttataaccaagggaacttaggttcgtgtactgcaaatgctggttgcact
tgtagagctatgctattgcaagataagcaaattcagttatcaagaatgttcttatattat
gaagaaagaaaattagaaggaaaaaccagcaaggatgatggggcaagtcttagagatacg
tgcaaatcaatctataagaaaggtgtttgtgaagaaaaatacatgccctataatccggaa
aattatatgttaccaccatcaaaacttgcaaaaataaatgcacgacaatacaagattatt
gcatataaatcattaagttccttagatgaaatcaagcaaaacttggcttttagacagcaa
ccagtattattaggaatgaatgtatatgaaagttttgaatcggatgcggtaactaaaacg
ggaattatgccaatgccacgcaagaacgaaaagaaactaggagctcatgctgttttaata
gttggttataaggacatagtgaagaatcatggtatgtctggtagaaacaaacatcaacaa
ggttatctttttgtgagaaattcatggggagataaatggggcgataaaggatatttctat
atgccatttgattatgtgatacctgattatacttttgattattggattatggaataa

DBGET integrated database retrieval system