KEGG   Clostridium sp. BNL1100: Clo1100_1931Help
Entry
Clo1100_1931      CDS       T01708                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
clb  Clostridium sp. BNL1100
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Clo1100_1931
  Lipid metabolism
   00561 Glycerolipid metabolism
    Clo1100_1931
   00600 Sphingolipid metabolism
    Clo1100_1931
Enzymes [BR:clb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Clo1100_1931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2239711..2241129)
Genome map
AA seq 472 aa AA seqDB search
MKKIKRLIALAILTVVFISPFPSSVQNGNQVLALNNGLGLTPPMGWNSWNIFGGDINEDK
IKQIADAMVTTGMKDAGYEYVNLDDNWMANPARDANGKLIPDPKRFPNGMKALADYIHSK
GLKFGIYGDRGVTTCCNIPQSGSQGYEEQDAKTFAEWGVDYLKYDNCASDSNLQAGYEKM
RDALLKTGRPIFYSICCWYFAGPWIIDCGNSWRTTGDISDNWGSITKNIDENSKSAAYAG
PGHWNDPDMLEVGNGKMSDTEYKAHFSMWCMMAAPLIAGNDIRNMTPATKEILTNKEVIA
IDQDVAGVQGTKVSTSGELEVWCKPLGVDGTTKAVILLNRGGASADITVNWRDIKLADGP
ATVRDLWEHKDCDTFNTGYTANVPSHGAVVLKVQTSSTDPAIMYGDVDGSGVIDALDYSL
HKRYLLGQISDFPESKGKLAADVDGDGQITALDFSLIKQYLLGIINKFPAQK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaaacgccttatcgccttggcaattttgacagtggtgtttatctcacca
tttccgtcatctgtccaaaatggcaatcaagtgctggccctgaacaacggtctgggattg
actccacccatgggttggaacagttggaacatctttggaggtgacatcaatgaagataag
attaaacaaattgcagatgctatggttacaacaggaatgaaggatgcaggctatgagtat
gtcaatcttgacgataattggatggcaaacccagctcgtgacgctaatggaaaacttatt
ccggatcccaaacgttttcctaacggtatgaaagctctggcagattatattcattcaaaa
gggttaaaatttggaatttatggtgataggggagtaaccacctgctgcaatattccccag
agtggaagtcaggggtatgaggaacaagatgctaaaacttttgctgaatggggtgtagat
tatttgaaatatgataactgtgcttcagatagtaatctgcaggcaggctacgaaaaaatg
cgggatgctcttttgaaaacaggaagacctattttctacagcatatgctgctggtatttt
gcgggtccatggataatagattgcggtaattcttggagaacaacaggagatattagtgac
aactggggaagtattacaaagaatattgatgaaaactccaagtcagccgcttacgcaggt
ccgggccattggaatgatccggatatgttggaggttggtaatggtaaaatgtcagataca
gaatacaaagcgcatttcagcatgtggtgcatgatggcagctccacttattgcaggaaat
gatattaggaatatgactcctgctaccaaagaaattcttaccaacaaagaagttattgct
attgaccaagacgttgcaggggtgcaaggtacaaaggtaagtacttcaggcgaacttgaa
gtgtggtgtaaaccgctgggggtagatggtactaccaaggcagttatcctcttgaatcga
ggaggcgcttcggcagatatcacagtcaattggagagatattaagcttgccgatggtcct
gctactgttcgtgatctttgggagcataaggattgcgacacgtttaacaccgggtataca
gccaatgtaccttcccatggtgcggtggtattaaaagttcaaacaagctccaccgatccg
gctataatgtatggtgatgttgatggaagtggcgtgattgatgcactagattattcatta
cataaacggtatctacttggccagatatccgattttcctgagtcaaagggcaaactggct
gccgatgttgatggagatggtcaaataacagcattggatttttcattaatcaagcaatat
ttgctgggaattattaataaatttcctgcacaaaaataa

DBGET integrated database retrieval system