KEGG   Clostridium sp. BNL1100: Clo1100_1989Help
Entry
Clo1100_1989      CDS       T01708                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
clb  Clostridium sp. BNL1100
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:clb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2308103..2309434)
Genome map
AA seq 443 aa AA seqDB search
MKKRNFRKTVSLLLILSLIATLLFTSNVFAASSLTDYKTATETVKNMGIGWNLGNTLEAC
GDWINGSSVKDYETAWGNPVTTKEMIDGIRAAGFKTVRIPVAWSNLMSADYTINSELLKR
VKEVADYCSANDLYAIVNIHWDGGWFEKFATEYDECMKKYTSVWTQISNYFKDYPKNLIF
ESLNEEGCWNSIWNRYGGSSGEDKTRAYNILNNINQKFVNIVRASGGNNSSRCLLIAGYA
TDIDLTCDDCFKMPTDTINNKLIISVHYYTPSTFTILEQDADWGKCATTWGTDTEINQVK
TDFTKMKNKFTNNGVPVIIGEYGTTTVNKDPTSVRLYITTVCKTAYDMGFCPLLWDSSTH
YSRTEGKIKDPQLAAMFLQYKESTTIVLGDVNADNTVDALDYAQLKKYLLGADNTINVKN
ADINGDGVIDALDFAKLKILLLK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacggaattttagaaaaacagtgtctttactactaattttatcgcttatagct
actttactatttacatcaaatgtatttgcagcatcttcgttaacagattataaaacagct
actgaaacagttaagaacatgggtattgggtggaatttaggaaatactcttgaagcttgt
ggcgattggataaacggaagctcggtaaaagactacgaaactgcatggggcaatccggtt
acaactaaggaaatgattgacggtattcgtgcagcaggctttaaaactgttcgtatcccg
gtagcttggtcaaatcttatgtcagctgattataccatcaatagtgagctcttgaagcgt
gttaaagaagtagcggattattgttcagctaacgatctttatgccattgtaaatattcac
tgggatggcggttggtttgaaaaatttgcaactgaatatgatgaatgtatgaagaaatac
acttcagtctggactcaaataagcaactatttcaaggattatcctaaaaaccttatattt
gaatctcttaacgaggagggttgctggaacagtatttggaacagatacggcggctcatcc
ggggaagataaaacaagagcatataatatacttaataatattaatcagaaatttgtgaat
attgtaagggcatcaggaggaaacaactcatctcgttgtcttctgattgcaggatatgca
accgatattgacctgacatgtgatgattgctttaaaatgcctactgatactataaataat
aaactgattatttcggtacattattatactccgtctacttttacaattcttgaacaggac
gctgactggggcaaatgtgcaactacatggggaacagatacagaaattaatcaggttaaa
actgattttactaagatgaaaaacaagtttacaaataacggggttcctgtgattatagga
gaatatgggactacaacagtaaataaggaccctaccagtgtaagactttatattacaaca
gtttgtaaaactgcatatgatatgggattttgtcctcttctttgggatagcagtactcat
tactccagaacagaaggaaaaatcaaggacccacagctcgcagcaatgtttttacaatac
aaagaatctaccacaatagtacttggagatgtaaatgcggataatacagttgatgctctt
gattatgcacaattgaaaaagtacctgttaggagccgataacactataaatgtaaagaat
gctgacataaatggagatggagtaattgatgcactggattttgcaaagttaaagatacta
ttactcaaataa

DBGET integrated database retrieval system