KEGG   Clostridium sp. BNL1100: Clo1100_2081Help
Entry
Clo1100_2081      CDS       T01708                                 

Definition
(GenBank) peptidase family protein
Organism
clb  Clostridium sp. BNL1100
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2407250..2408236)
Genome map
AA seq 328 aa AA seqDB search
MQETLKTVTQAFGVSGNEEDIREIITSEIKKYVDEIKVDAMGNLIAVKKGKKKKILFAAH
MDEIGVIATFIDDKGFIRFSNLGGVSAFNSLAQRVRFKNGTVGCINAEEKLESMKDLRLG
KMYIDIGCTSKEEAEKYVKVGDTASFTGDFHVQGDFAVSKAMDDRSGCAVLIELIKTMPK
TDNEIYFVFTTQEELGLRGAKTASFGIMPDCAIAIDVTRTGDTPECNSMEVKLGKGPAIK
VKDSSYIAHPQIRRTLQDLAQENNIPYTLELLERGGSDPGAMQTSGTGIPCGGISIPCRY
VHTPCEMVSIQDLNNCVKLAGLFMKHYK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaacattaaaaacagttacacaggcctttggtgtatccggaaatgaagaagat
atcagagaaataattacttctgaaataaaaaaatatgttgatgaaataaaagttgatgca
atgggaaatctgattgcagtaaaaaaaggaaaaaagaagaaaatcctatttgcggcccat
atggatgaaattggtgtcatagctacctttattgatgataaaggatttataaggttttcc
aatttagggggagtatcagcgttcaattcccttgcacaaagagtgaggtttaaaaacggc
acagtgggttgtataaatgcagaagagaaacttgaaagcatgaaggatctcagacttgga
aaaatgtatattgatatcggctgcaccagcaaagaggaagctgagaaatacgtaaaggtt
ggagatacagccagctttacaggcgattttcatgttcagggggattttgccgtttcaaag
gcaatggatgacaggagcggctgtgcagtacttattgagcttataaaaaccatgcctaaa
acagataatgaaatttactttgtctttactactcaggaagaattgggactgagaggtgca
aagacagcttctttcggaattatgccggattgtgccatcgcaattgatgttacacgtaca
ggtgatacaccggaatgtaacagtatggaagtaaagcttggcaagggccctgcaataaaa
gtaaaagattcttcttatatagctcatccacagattcgcaggactttacaggatttagcc
caggaaaacaatattccctataccttggaattactggaaaggggagggagtgatcccggc
gcaatgcagacatctggaacaggaataccatgcggaggtatatcaattccatgcaggtat
gttcataccccttgtgaaatggtgagcattcaagatttaaataactgtgtcaagctggcg
ggtctgtttatgaaacattacaagtaa

DBGET integrated database retrieval system