KEGG   Clostridium sp. BNL1100: Clo1100_2121Help
Entry
Clo1100_2121      CDS       T01708                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
clb  Clostridium sp. BNL1100
Pathway
clb00230  Purine metabolism
clb01100  Metabolic pathways
Module
clb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Clo1100_2121
Enzymes [BR:clb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Clo1100_2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 AAA_33 AAA_16 Cytidylate_kin MMR_HSR1 RNA_helicase AAA ADK RsgA_GTPase AAA_17 NTPase_1 AAA_28 T2SSE ABC_tran AAA_30 cobW
Motif
Other DBs
NCBI-ProteinID: AEY66307
UniProt: H2JD74
Position
complement(2452870..2453475)
Genome map
AA seq 201 aa AA seqDB search
MQQKGLLVVVSGPSGTGKGTVCKKLLSQRENVRYSVSATTRKPREGEIEGQSYFFVSESK
FLDMIKNDALIEWDKYCDNYYGTPKSYVDSCMENGMDIILEITVEGALEIKQKYPDSVLI
FILPPSFDELRRRIECRATECTDVIEKRLQKAANEIKYVSKYDYLILNDSVDEAVLNIEK
VLDSERLKPSRNIEMIESLFK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaaaaggcctattagttgtagtgtccggaccttcaggaacaggaaagggtacg
gtatgcaaaaagttgttgtctcaaagggaaaatgtaaggtattctgtttcagctactacc
agaaaaccacgtgaaggtgaaattgagggccagagctatttctttgtttcagaaagcaaa
tttttggatatgataaagaatgatgccctcatcgagtgggataagtactgtgacaattac
tatggaacaccaaagtcatatgttgattcctgcatggaaaacggtatggacataatattg
gaaataaccgttgaaggggctcttgaaataaagcaaaagtaccctgattccgtacttata
tttattctgccgccgtcctttgatgaattaagaaggagaatagagtgcagagctacagag
tgtactgacgttatagaaaaaagattgcaaaaggctgccaacgaaattaaatatgtttca
aaatatgactatttaattttaaatgacagtgttgatgaagcagttttgaatatagaaaag
gttttagatagcgagcggttaaagccatccagaaatattgaaatgatagaaagtttattc
aagtaa

DBGET integrated database retrieval system