KEGG   Clostridium sp. BNL1100: Clo1100_2388Help
Entry
Clo1100_2388      CDS       T01708                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
clb  Clostridium sp. BNL1100
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:clb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Clo1100_2388
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Clo1100_2388
Enzymes [BR:clb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Clo1100_2388
Two-component system [BR:clb02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Clo1100_2388
Bacterial motility proteins [BR:clb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Clo1100_2388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2721580..2722650)
Genome map
AA seq 356 aa AA seqDB search
MSLNLKKNNPIKVLIVDDSAFMRKVLSDMLNSDNSISVVGTAVDGKDALEKIHHLHPDVV
TLDVDMPVMDGINCLRQIMQRIPRPVIMFGSETEYGTEMTIRALDEGAVDFVVKPKNIFE
IKNDSKRNEIIEKIIIAKNIKLKSIQKKSIDNDKRVTSKSTKPVKNIIAIGSSTGGPKAL
QTVIPYLPRDMSIAVLVVQHMPPGFTKSLAERLDSKSDLIVKEATHKEKVLEGYAYIAPG
DSHMKIQTSANGDIIINLDKSPPVGGHRPSVDVMMTSLSETGLKNIIGVILTGMGADGSV
GIKKLKEVNKSFIIAQDEETSVVYGMPKMAVQTGAVDKIVSLDKIPSEIIQYLGVR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaaatttaaaaaagaacaatccaataaaggtattgattgtagatgattctgca
tttatgagaaaagtgttatcagacatgcttaactcagataattctatttctgtggttggt
actgctgttgatggcaaggatgcattggaaaaaatacatcatctgcatccggatgtggta
acattagatgtagacatgcctgtaatggacggaattaactgtctgaggcaaattatgcag
agaattccaagacccgtaataatgtttggaagtgaaacagagtatggtactgaaatgacc
ataagagcactggatgaaggtgcagttgattttgttgtaaagcccaagaatatatttgaa
attaaaaatgattctaaacgaaatgaaataatagaaaaaattattatagctaaaaatatt
aagctaaaatctattcagaaaaagtcgatagataatgataaaagagtgacctcaaaaagc
acaaagcctgtgaaaaatattatagcaatcggaagttctacaggtggaccaaaggcattg
caaacggttataccttatttaccgagagatatgtccatagcagttctggttgttcagcac
atgcctcccggatttacaaagtctcttgcagaaagactggatagtaagagtgacttgata
gtcaaagaagcaacccataaagaaaaagtacttgagggttatgcatatatagcaccgggg
gactcacacatgaagattcaaacatctgcaaatggtgatataataattaatttggacaaa
tctcctcctgtcggaggacacagaccatcagtagatgttatgatgacttctttgtcggaa
actgggctaaaaaatataatcggtgttattctgacaggtatgggtgctgatgggagtgta
ggaattaaaaaattaaaggaagtaaataaaagttttataatagcccaagacgaagaaaca
agcgtagtttatggaatgccgaaaatggcagtacaaaccggtgcagtagacaaaatagta
tcacttgataaaattccaagtgaaataatccaatatttgggggtgcgttaa

DBGET integrated database retrieval system