KEGG   Clostridium sp. BNL1100: Clo1100_2661Help
Entry
Clo1100_2661      CDS       T01708                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1100_2661
   01230 Biosynthesis of amino acids
    Clo1100_2661
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1100_2661
   00030 Pentose phosphate pathway
    Clo1100_2661
   00051 Fructose and mannose metabolism
    Clo1100_2661
   00052 Galactose metabolism
    Clo1100_2661
  Energy metabolism
   00680 Methane metabolism
    Clo1100_2661
Enzymes [BR:clb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clo1100_2661
Protein phosphatases and associated proteins [BR:clb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Clo1100_2661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3036015..3037262
Genome map
AA seq 415 aa AA seqDB search
MTVLKGAAIFGQSGGPTSVINASACGVFQEALKQDAITAVYGAAHGIKGILDEKFYDMSK
EDAYELDLLKTTPSSALGSVRYKLKSADEDETDYKRLVEVFKKYDIRYFFYNGGNDSMDT
CNKVSKYMQKVGYECRVMGVPKTIDNDLFGTDHCPGYSSAAKYIATSTMEVYHDARVYNT
GMITILEVMGRNAGWLTAATALAAYKGAGPDLIYLPEIDFDMDQFLADCTRIYKENGNCI
VAVSEGIKDKNGKYISEYGSNLTDQKDSFGHAQLGGLAATLAAIVKEKTGAKVRGIEFSL
LQRCAAHCGSASDVNESYMSGQMAVRYAVEGMTDKMVGFKRAEGSEYKCEIQLLDLNDVA
NTEKKIPREWINEAGNGLKQEFIDYALPLIQGESAPPKEDGLPRFAKLKKVLATK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgactgttttaaaaggcgccgctattttcggacaatcaggtggaccaacatcagtaatt
aatgccagtgcttgcggagtatttcaggaagcattaaagcaagatgcaataacagctgta
tatggtgcagctcacggtatcaaaggtattcttgatgaaaaattctatgacatgagcaag
gaagatgcttatgagcttgacttattaaagactactccttcttcagctctcggttctgtt
cgttacaagcttaaatcagcagacgaggacgaaacagattacaagagacttgttgaagtt
ttcaagaaatatgatatcagatatttcttctataacggtggaaatgattcaatggatact
tgtaacaaggttagcaagtacatgcagaaggttggctatgaatgtagagtaatgggtgtt
ccaaagactatagacaatgaccttttcggaacagaccactgccctggatattcaagtgcc
gctaagtacatcgctacatcaactatggaagtttaccatgatgcaagagtttacaataca
ggtatgattacaatacttgaagttatgggaagaaacgcaggttggctgacagctgcaact
gctcttgctgcttataagggtgcaggtcctgacttgatatacctccctgaaatcgatttt
gatatggatcagttccttgctgactgtactagaatttacaaagaaaacggaaactgtatc
gttgctgtttcagaaggtattaaggacaaaaacggtaaatacatttcagaatacggctca
aaccttactgatcagaaagactcattcggtcatgcacagttaggtggtcttgctgctact
ctggctgcaattgttaaggaaaagaccggagcaaaggttcgtggtatcgaattcagcctt
ctccaaagatgtgctgctcactgcggttctgcaagcgacgtaaacgaatcctacatgtca
ggccaaatggctgtaagatatgctgttgaaggaatgactgacaagatggttggcttcaag
agagctgaaggaagcgaatacaaatgtgaaattcagttacttgatttgaacgatgttgca
aatacagaaaagaagattcctagagaatggattaacgaagctggaaatggcttaaagcaa
gagtttatcgactacgctttaccattaatccaaggtgaatcagctccacctaaggaagac
ggtcttcctagatttgcaaaactaaaaaaagttcttgcaactaaataa

DBGET integrated database retrieval system