KEGG   Clostridium sp. BNL1100: Clo1100_2704Help
Entry
Clo1100_2704      CDS       T01708                                 

Definition
triosephosphate isomerase
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:clb01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:clb01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:clb00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:clb00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:clb00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3081786..3083726)
Genome map
AA seq 646 aa AA seqDB search
MSMMNKKTIEDIDVAGKKVIVRVDFNVPLDADRKITDDKRIVGALPTIKYLVDKGAKTIL
VSHLGRPKEGFEDKFSMKPTAVRLGELLGKEVIMAKDVVGEDAKAKAAALKDGEVLMLEN
VRFHKEETKNDANFAKELASMAEIFVNDAFGTAHRAHASTAGLADYLPAVCGFLIKKEID
FMGKALANPARPFVAILGGAKVSDKIAVIENLIDKVDTLIIGGGMAYTFLKAKGYHIGNS
ICEDDKLELAKTLMEKAEAKGVNMMLPIGSMVAQEFKNDTEIKYVPSDAMPDGWMGMDIG
SLTIEKFAKEIKKSKTVIWNGPMGVFEFPNFATGTKEIAKAVAESGALSIVGGGDSAAAV
EQLGFADKITHISTGGGASLEFLEGKELPGIAVLMDKNPRKVIAAGNWKMNKTASEAVTF
VNALKPAVADAKNEVVVGVPFVCLPGVVEAAKGSNIKVAAQNMHWEENGAFTGEVSGPML
ADLGVDYVIIGHSERREYFGETNEMINKKAHAIFKYGMTPIICCGETLTQREQGVTADHI
RYQIKVALLGLTAEQVSKLVIAYEPIWAIGTGKTATNEQANEVCTIIRELVVELYGSEVA
EQVRIQYGGSVNAKNAADLFAMSDIDGGLVGGASLKVEDFSIIAKA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgatgaacaaaaaaacaattgaagacattgatgttgccggcaaaaaggtaata
gtaagagttgattttaacgtgccattggacgcagacagaaagattactgatgacaagaga
atagttggagcacttcctacaatcaaatatcttgttgacaagggagctaagactatactt
gtatcccatttaggaagaccaaaggaaggttttgaagataaattcagcatgaagccaaca
gctgttagacttggcgaacttcttggaaaagaagtaataatggctaaagatgttgtaggc
gaagatgcaaaggcaaaggctgctgcattaaaagacggcgaagttcttatgcttgagaac
gtaagattccataaggaagaaacaaagaacgatgctaactttgcaaaagaacttgcaagc
atggctgaaatatttgtaaatgatgcattcggtactgctcacagagcacacgcttctact
gcagggttggctgactatcttcctgctgtatgcggattccttataaagaaagaaatcgat
ttcatgggtaaggcattagctaaccctgcaagaccattcgtagcaatccttggtggtgca
aaggtttctgacaaaatcgcagttattgaaaacctcattgacaaggttgatactttgata
atcggtggtggtatggcttataccttcttaaaggcaaaaggatatcacatcggaaattca
atctgtgaagacgacaagcttgagcttgctaagactcttatggaaaaagcagaagcaaag
ggagttaacatgatgcttccaataggaagtatggtagctcaggaattcaagaacgatact
gaaatcaaatacgttccatcagatgcaatgccagacggatggatgggtatggatatcgga
tcacttacaattgaaaaattcgcaaaagaaataaagaaatcaaagacagttatctggaac
ggacctatgggcgtatttgaattccctaactttgcaacaggtacaaaggaaattgcaaag
gcagttgcagaatcaggagcactttctatagttggaggcggagattcagctgctgcagtt
gaacaactcggtttcgctgataagattacacatatttcaacaggtggaggagcttctctt
gaattcctcgaaggtaaagagcttccgggtatagcagtacttatggataaaaatccaaga
aaagtaattgctgctggtaactggaaaatgaataagactgcttctgaagctgttacattt
gtaaatgcattaaagcctgctgttgctgatgcaaaaaatgaagtagtagttggtgttcca
tttgtatgcctgcctggagttgttgaagctgctaagggttcaaacataaaggttgcagca
cagaatatgcactgggaagaaaacggagcatttacaggagaagtttcaggcccaatgctt
gcagaccttggtgttgactatgtaataatcggtcactccgaaagaagagaatatttcggt
gaaaccaacgaaatgataaacaaaaaggctcatgcaatattcaaatatggaatgactcca
atcatctgctgtggtgaaacactcactcagagagaacagggagttacagctgaccatatc
agatatcagataaaggtagcattacttggcttgactgctgaacaggttagcaagcttgtt
attgcatacgaaccaatctgggctatcggaacaggtaagactgctacaaatgaacaggca
aatgaagtttgcacaattatcagagagttggttgtagagctttacggctcagaagtagct
gaacaggttagaatccagtacggcggaagcgtaaatgcaaagaacgctgctgacttgttt
gcaatgtctgatatagacggaggactcgttggtggagcaagcttaaaggttgaggatttc
tcaataatagcaaaagcataa

DBGET integrated database retrieval system