KEGG   Clostridium sp. BNL1100: Clo1100_2704Help
Entry
Clo1100_2704      CDS       T01708                                 

Definition
triosephosphate isomerase
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1100_2704
   01230 Biosynthesis of amino acids
    Clo1100_2704
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1100_2704
   00051 Fructose and mannose metabolism
    Clo1100_2704
   00562 Inositol phosphate metabolism
    Clo1100_2704
Enzymes [BR:clb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Clo1100_2704
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Clo1100_2704
Exosome [BR:clb04147]
 Exosomal proteins
  Proteins found in most exosomes
   Clo1100_2704
  Exosomal proteins of colorectal cancer cells
   Clo1100_2704
  Exosomal proteins of bladder cancer cells
   Clo1100_2704
  Exosomal proteins of melanoma cells
   Clo1100_2704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3081786..3083726)
Genome map
AA seq 646 aa AA seqDB search
MSMMNKKTIEDIDVAGKKVIVRVDFNVPLDADRKITDDKRIVGALPTIKYLVDKGAKTIL
VSHLGRPKEGFEDKFSMKPTAVRLGELLGKEVIMAKDVVGEDAKAKAAALKDGEVLMLEN
VRFHKEETKNDANFAKELASMAEIFVNDAFGTAHRAHASTAGLADYLPAVCGFLIKKEID
FMGKALANPARPFVAILGGAKVSDKIAVIENLIDKVDTLIIGGGMAYTFLKAKGYHIGNS
ICEDDKLELAKTLMEKAEAKGVNMMLPIGSMVAQEFKNDTEIKYVPSDAMPDGWMGMDIG
SLTIEKFAKEIKKSKTVIWNGPMGVFEFPNFATGTKEIAKAVAESGALSIVGGGDSAAAV
EQLGFADKITHISTGGGASLEFLEGKELPGIAVLMDKNPRKVIAAGNWKMNKTASEAVTF
VNALKPAVADAKNEVVVGVPFVCLPGVVEAAKGSNIKVAAQNMHWEENGAFTGEVSGPML
ADLGVDYVIIGHSERREYFGETNEMINKKAHAIFKYGMTPIICCGETLTQREQGVTADHI
RYQIKVALLGLTAEQVSKLVIAYEPIWAIGTGKTATNEQANEVCTIIRELVVELYGSEVA
EQVRIQYGGSVNAKNAADLFAMSDIDGGLVGGASLKVEDFSIIAKA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgatgaacaaaaaaacaattgaagacattgatgttgccggcaaaaaggtaata
gtaagagttgattttaacgtgccattggacgcagacagaaagattactgatgacaagaga
atagttggagcacttcctacaatcaaatatcttgttgacaagggagctaagactatactt
gtatcccatttaggaagaccaaaggaaggttttgaagataaattcagcatgaagccaaca
gctgttagacttggcgaacttcttggaaaagaagtaataatggctaaagatgttgtaggc
gaagatgcaaaggcaaaggctgctgcattaaaagacggcgaagttcttatgcttgagaac
gtaagattccataaggaagaaacaaagaacgatgctaactttgcaaaagaacttgcaagc
atggctgaaatatttgtaaatgatgcattcggtactgctcacagagcacacgcttctact
gcagggttggctgactatcttcctgctgtatgcggattccttataaagaaagaaatcgat
ttcatgggtaaggcattagctaaccctgcaagaccattcgtagcaatccttggtggtgca
aaggtttctgacaaaatcgcagttattgaaaacctcattgacaaggttgatactttgata
atcggtggtggtatggcttataccttcttaaaggcaaaaggatatcacatcggaaattca
atctgtgaagacgacaagcttgagcttgctaagactcttatggaaaaagcagaagcaaag
ggagttaacatgatgcttccaataggaagtatggtagctcaggaattcaagaacgatact
gaaatcaaatacgttccatcagatgcaatgccagacggatggatgggtatggatatcgga
tcacttacaattgaaaaattcgcaaaagaaataaagaaatcaaagacagttatctggaac
ggacctatgggcgtatttgaattccctaactttgcaacaggtacaaaggaaattgcaaag
gcagttgcagaatcaggagcactttctatagttggaggcggagattcagctgctgcagtt
gaacaactcggtttcgctgataagattacacatatttcaacaggtggaggagcttctctt
gaattcctcgaaggtaaagagcttccgggtatagcagtacttatggataaaaatccaaga
aaagtaattgctgctggtaactggaaaatgaataagactgcttctgaagctgttacattt
gtaaatgcattaaagcctgctgttgctgatgcaaaaaatgaagtagtagttggtgttcca
tttgtatgcctgcctggagttgttgaagctgctaagggttcaaacataaaggttgcagca
cagaatatgcactgggaagaaaacggagcatttacaggagaagtttcaggcccaatgctt
gcagaccttggtgttgactatgtaataatcggtcactccgaaagaagagaatatttcggt
gaaaccaacgaaatgataaacaaaaaggctcatgcaatattcaaatatggaatgactcca
atcatctgctgtggtgaaacactcactcagagagaacagggagttacagctgaccatatc
agatatcagataaaggtagcattacttggcttgactgctgaacaggttagcaagcttgtt
attgcatacgaaccaatctgggctatcggaacaggtaagactgctacaaatgaacaggca
aatgaagtttgcacaattatcagagagttggttgtagagctttacggctcagaagtagct
gaacaggttagaatccagtacggcggaagcgtaaatgcaaagaacgctgctgacttgttt
gcaatgtctgatatagacggaggactcgttggtggagcaagcttaaaggttgaggatttc
tcaataatagcaaaagcataa

DBGET integrated database retrieval system