KEGG   Clostridium sp. BNL1100: Clo1100_2769Help
Entry
Clo1100_2769      CDS       T01708                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
clb  Clostridium sp. BNL1100
Brite
Enzymes [BR:clb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Clo1100_2769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3152166..3155318)
Genome map
AA seq 1050 aa AA seqDB search
MYRNRNKVLALLLAFAMLISVMPFSSVMADTKTTYHETFADGKGAASQSGGANLDKVGNK
VFEGNDDGVALYVSNRKNNWDAADFKFTDIGLKNGKTYNITVKGFVDSNAKVPAGAQAFL
QVANSYAWLAGAEFVAGKAFTLSGKYTVDTSKDDRVRVQSNDEGKEVPFYIGDISITEEA
VEEVPVDPNQPKAETFKTITFEDNATGGFEARGGEGSEKLTVTKEANHTDGGSYALKVEN
RTMTWHGPSMHVEKFVSQGSEYKVTAWVKLISPESSQLQLSTQVGNGGSASYVSLAAKTI
GTSDGWVKYEGTYRYNNVSSGFITIYVESASSANASFYIDDISFEQTGSGPIKIQNDLKS
IKDVYKNDFLIGNAIAAEDMEGIRLDLLKKHFNVMTAGNAMKPDALQPTKGNFTFADADK
LVDKVLAEGFKMHGHTLVWHQQSPAWLNTKVDASGNTVPLSREEALTNLRTHIKTVVEHY
GNKVISWDVVNEGMNDNPTNPEDWKGALRQSPWYQAIGPDYMEQAFLAAREVLDAHPDWD
VKLYYNDYNDDNQNKSKAIYYMVKELNEKYAKTHPGKRLIDGVGMQAHYNMSTNPSNVEL
SLERFISLGVEVSITELDVQAGSDFKLSDDVANAQGYLYAQLFDIYKKHAADISRVTIWG
IDDGTSWRSSTNPLPFDKNLQAKPAFFGVVDPAKFMAEHKPQTPKGAKLTTAKYGTPVID
GTVDSVWSKAQVIPVNTYQMAWQGATGTAKALWDDKNLYVLVQVSDSELDKKSANTYEQD
SVEVFFDENNGKTSFYQDDDGQYRVNFDNETSFNPAAISAGFESATKVSGTSYIVEIKIP
FKSVTPSNNMKVGFDVQVNDAKDGSRKSVATWNDTTGTGYQDTSVYGVLTLSNSESNNTA
NYITRGEFIDSIIKALGLNKNVQVKDSFKDVTKDASYYASVSVAYQKGIISGYKNGEFKP
QAKITRQEAMTIIAKAMKVAGKNANYSADEINKILKEFKDSNKVAGWAKGSVAACIKAGI
VSGKSGKMLAPQENITVSQTESIVKKLSAK
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggaacagaaataaagtcttagcattgcttttagcttttgcaatgctcatttcc
gttatgccttttagctcagtaatggcagatacaaaaactacttatcacgaaacttttgca
gacggaaagggagcagcatcccaatccggaggagctaatcttgacaaggttggaaataag
gtttttgaaggtaatgatgatggggtagcattatatgtaagcaacagaaaaaataactgg
gacgcagctgatttcaaatttaccgatattggattaaaaaacggtaagacttataacata
accgtaaaaggttttgttgactccaatgccaaggttccggcaggtgcacaggcatttctt
caggttgcaaacagctacgcatggctggcaggtgcagaattcgttgcaggaaaggctttc
acattaagcggaaagtatactgttgatacttcaaaggacgacagagtacgtgttcaatct
aatgatgaaggtaaagaggttcctttctatatcggagacatttcaataacagaagaggcc
gttgaagaagtacccgttgatcctaaccaaccaaaggcggaaactttcaaaacaataaca
tttgaagataatgccacaggaggctttgaagccagaggcggtgaaggatcagaaaaactg
actgtaacaaaagaagccaaccatacagatgggggttcatacgcattaaaagtagaaaac
agaacaatgacctggcatggtccttcaatgcatgttgagaagtttgtaagccaaggtagc
gaatacaaggttactgcatgggtaaaacttattagtcctgaaagctcacaacttcaactc
tcaacacaggttggaaatggtggaagtgcttcttacgtaagccttgcagcaaaaacaata
ggtacttctgacggttgggttaaatatgagggtacataccgctacaacaatgtttcaagc
ggattcattactatatatgtagaaagcgcaagcagtgctaatgcatccttctatattgat
gatatcagctttgaacaaacaggttcaggaccaattaaaatccaaaatgatttgaaatct
atcaaagatgtatataaaaatgatttccttattggaaacgcaatagcagcagaggatatg
gaagggatcagacttgatcttctaaagaagcactttaatgtaatgaccgccggcaacgct
atgaagcctgatgcattacagcctacaaagggcaactttacattcgcagatgcagataaa
cttgttgacaaggttttggcagagggattcaagatgcacgggcataccctcgtttggcat
cagcagtcacctgcatggctaaatacaaaagttgatgcaagcggaaataccgtacctttg
tcacgtgaggaagctcttacaaatctgagaactcatattaagacagttgttgagcattac
ggtaacaaggtaatatcctgggacgtagtaaatgaaggtatgaacgataatcctactaac
ccagaagactggaagggcgcattgcgtcaaagcccatggtatcaggcaattggcccagat
tacatggaacaggcgtttttagcagcaagagaggttctggatgctcatcctgattgggat
gtgaagctttattataatgattataacgatgataatcaaaataaatctaaagctatttat
tatatggtaaaagaattaaatgaaaaatatgcaaaaactcatcccggcaagcgtcttatc
gacggtgtaggtatgcaggcacattacaacatgtcaacgaatccttccaacgttgaactt
tctttggagagatttatttcactgggtgttgaagtaagcataacagagcttgatgttcag
gcaggcagtgacttcaaattgtcagatgatgttgcaaacgcacagggatatttgtatgca
cagttattcgatatatataagaagcatgcagcagatataagccgtgttactatttgggga
atagatgacggtacaagctggagatcatccacaaatcctttaccgtttgataaaaatctt
caggcaaagcctgcgtttttcggggtagtagacccggctaagttcatggccgaacataaa
cctcaaacacctaaaggtgctaaattaacaactgcaaaatatggaacacctgtaatagac
ggtaccgtagacagtgtttggagtaaagcacaggttatacctgtaaacacatatcaaatg
gcatggcagggagcaacaggaactgcaaaggctctctgggatgacaaaaatctttatgtt
ctcgttcaggtaagtgactcagagcttgataagaagagtgcaaatacatacgaacaagac
tctgttgaagtattctttgatgagaacaacggaaaaacttcattctatcaggatgatgac
ggtcagtacagagtaaactttgataatgagacttcatttaaccctgcagcaatttcagcc
gggtttgagtctgcaactaaagtctcaggaacaagctatattgttgaaataaagatacct
tttaaatctgtaactccttccaataatatgaaagttggttttgatgttcaggttaatgat
gctaaagacggttcacgtaagagtgttgcaacctggaacgatactacaggaacaggatat
caggatacatcagtatatggtgttcttaccctcagtaattctgaaagcaataatacagct
aattacattacaagaggagaatttattgattctatcattaaagctttaggtttgaataaa
aatgttcaggttaaagactccttcaaagatgtaaccaaggatgccagctattatgcttct
gtaagtgttgcttaccaaaaaggcataatatcaggatacaagaatggagaatttaagcca
caggctaagattactcgtcaggaagcgatgacaataattgccaaggctatgaaggtagca
ggaaaaaatgccaattactcagctgatgagataaataaaatacttaaggaatttaaggat
tcaaacaaagttgccggctgggcaaaaggttctgttgctgcttgtattaaagcaggaatt
gtgtcaggcaaaagcggaaaaatgctggcgccacaagaaaatataactgtttcacaaaca
gaatcaatagtaaagaaattgtccgcaaaataa

DBGET integrated database retrieval system