KEGG   Clostridium sp. BNL1100: Clo1100_2996Help
Entry
Clo1100_2996      CDS       T01708                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
clb  Clostridium sp. BNL1100
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clo1100_2996
Enzymes [BR:clb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Clo1100_2996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3424208..3425632)
Genome map
AA seq 474 aa AA seqDB search
MKKTIAFLLCFLMIFTALLPMQNANAYDASLIPNLQIPQKNIPNNDAMNFVKGLRLGWNL
GNTFDAYNGTNITNELDYETSWSGIKTTKQMIDTIKQKGFNTVRIPVSWHPHVSGSDYKI
SDAWMNRVQEVVNYCIDNKMYVILNIHHDVDKVKGYFPSSQYLTSSKKYITSVWAQIAAR
FANYDQHLIFEGMNEPRLVGHANEWWPDLTNSDIIDSINCINQLNQDFVNTVRAAGGKNA
SRYLMCPGYVASPDGATNDYFRMPNDSGNNNKIIVSVHAYVPWNFAGLAMADGGTNAWNI
NDSKDQSEVTWFMDNIYNKYTSRGIPAIIGECGAVDKNNLKTRVEYMSYYVAQAKARGIL
CVLWDNNNFSGTGELFGFFDRRNCQFKFPEIMDGMLKYAFEPQTEPDPVIVYGDYNNDGS
VDALDFAGLKKYIMAADHAYVKNLDVNLDNEVNAFDLAILKKFLLGMVSKLPSN
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaatagcttttttactgtgttttctaatgatttttacagcattattgcca
atgcaaaatgctaatgcgtatgatgcttcacttattccgaatcttcagattccacaaaag
aacattccgaataatgatgcaatgaattttgtaaaaggtttaagacttggatggaatctg
ggtaatacatttgatgcttataacggtacaaatattactaatgaattggattatgaaaca
tcatggagcggtatcaaaacaactaagcagatgattgatacaataaagcaaaaaggattc
aatactgttcgtattcctgtatcctggcatccacacgtaagtggttcagattacaaaatc
agtgatgcgtggatgaatcgtgttcaagaagtagtaaattattgtatagataataaaatg
tatgtcattttaaacatacatcatgacgttgacaaagtaaaaggttatttcccaagcagt
caatatttaacaagctctaagaaatatataactagtgtctgggcacagattgctgctagg
tttgcaaactacgatcaacatcttatttttgaaggaatgaatgagcctcgtcttgtagga
catgctaatgagtggtggcctgatctgacaaattcagatattattgattctattaattgt
attaatcaacttaatcaggatttcgttaatacagtacgtgcagcaggtggaaaaaatgca
agcagatatctaatgtgtccgggatatgttgcatctcctgacggagcaacaaacgattac
ttcagaatgccaaatgattcaggtaataataataaaataatcgtatcggtacatgcatac
gtaccttggaattttgcagggttggcaatggctgatggaggtacaaatgcttggaatata
aatgattcaaaagatcaaagtgaagttacttggtttatggataatatttacaataagtat
acaagcaggggtattcctgcaataatcggtgaatgtggagcagtagataagaacaatctg
aagacaagagtagaatatatgtcctattatgttgcacaagctaaagcacgtggtatatta
tgcgtattgtgggataacaataatttctcgggtactggagaattatttggtttctttgat
agaagaaactgccagtttaagttccctgaaattatggatggaatgctaaaatatgctttc
gaaccacaaactgagcctgatccagtaattgtatatggagactataacaacgatggaagt
gttgatgcacttgattttgcaggcttaaagaaatatattatggctgccgaccatgcctat
gttaaaaatttggatgttaatctagacaatgaagtaaatgcttttgaccttgcaattttg
aaaaaattcctgcttggtatggtaagtaagcttccaagcaactaa

DBGET integrated database retrieval system