KEGG   Clostridium sp. BNL1100: Clo1100_3009Help
Entry
Clo1100_3009      CDS       T01708                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clo1100_3009
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clo1100_3009
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clo1100_3009
Enzymes [BR:clb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clo1100_3009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3442024..3442746)
Genome map
AA seq 240 aa AA seqDB search
MKLICYLSNGYPTIESSIEMAKDYIDAGCDIIEVDFPSSDPYLEGEYIANRMKEALAACN
DYEKYMDGIVEIKNSHPNTKFILLSYENTILEIGVDRFIKFCVDNNMMDLIYVGKDNQEV
KSKLIANGIKISCYVQFHMDENEIKAAVESNGFVYMQAKPTTNNVNPKFPTLKDCIDHLK
SLGIKREIYCGVGIYAPEDIKMAKEAGADGVFVGSTVLKLHTDIPKMKETIALFKKTCNE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactaatatgttatttatccaacggatacccaacaatagagtcaagcatagagatg
gctaaggactatattgacgcaggctgtgacattattgaggtggattttccttcctctgac
ccttaccttgaaggggaatatatcgcaaatagaatgaaagaggctcttgcagcctgcaat
gattacgaaaagtacatggatggaattgtagagattaaaaacagccatcccaatactaag
tttatattattgtcctatgaaaatacaattcttgagattggggtagaccgttttattaag
ttctgtgttgataacaatatgatggatcttatctatgtaggaaaagacaatcaggaagtt
aaaagcaagcttattgctaacggtataaaaatttcctgctacgttcaatttcacatggat
gaaaatgaaattaaggcggcagttgagtccaacggatttgtgtacatgcaggcaaagcca
actaccaacaacgttaatcctaaattcccaaccctcaaggattgtatagatcatttgaag
agtctaggaataaaaagggagatatactgcggtgtgggcatatatgcacccgaagacata
aaaatggccaaagaagcaggagctgacggtgtttttgtgggaagtacagtacttaagctt
catacggatattccaaaaatgaaagaaacaattgctttgtttaaaaagacctgcaatgaa
taa

DBGET integrated database retrieval system