KEGG   Clostridium sp. BNL1100: Clo1100_3078Help
Entry
Clo1100_3078      CDS       T01708                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:clb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:clb00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:clb00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:clb00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:clb00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:clb00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:clb00524]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3508189..3509139)
Genome map
AA seq 316 aa AA seqDB search
MSKLAIGIDIGGTNIKAALIDSTGSVSDFCKIPTNAKEGFKKTFISIQNLIQRYIDSIGK
DNIVGIGCACTGQVDSVSGKVLYAASTIPELSEFELKKNLVAFTNLPVEVENDVNACALG
EKWLGAARDVEDFLCITLGTGIGGAIYKNGGIEHGYRGVAAEFGHMSIDMNGEQCNCGNK
GCFERYGSVTALIKHFKEELLNGNKSIVTDMVNGHTENISGEIIYAAKSSGDPLATKIVK
EYNEAIICGTVSLVHIFNPEAVIFGGGITTLGDIFIEPIKKELLSRLMPVFREDLIIRRA
ELGDNAAICGIVRELF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaactggctataggaatagatattgggggtacaaatataaaagctgctcttatt
gacagtacaggaagcgtttcggatttttgtaaaattcctactaatgcaaaggaaggcttt
aaaaaaacatttatttcgatacaaaacctaatccaaagatatattgattctattgggaag
gataatatagtgggaataggatgtgcttgcacaggtcaggttgacagtgtcagtggaaaa
gttttatatgccgcaagtacaataccggaattgtctgaatttgaactgaaaaaaaacctc
gtagcatttaccaaccttcctgttgaagtcgaaaatgatgtgaatgcatgtgcattaggg
gaaaaatggttaggcgcagcaagggatgttgaagatttcttatgtataacccttgggaca
ggaattggcggagccatttataaaaatggtggcattgaacacggatacagaggtgtagca
gcagaatttggacatatgagcattgatatgaatggagaacaatgtaactgcggtaataag
ggctgctttgaaagatatggttccgttacggccctgattaaacatttcaaggaagaatta
ttaaatggaaataagtctattgtcacagatatggtaaatggacatacagaaaatataagc
ggtgagattatttatgcagcaaagtcttcaggcgaccctcttgctactaaaatagttaaa
gagtataatgaggctataatttgtggaacagtatcacttgttcacatttttaatcctgaa
gctgtaatttttggaggtgggataaccactttaggggatatatttatagaacctattaaa
aaagaattgttatccagactgatgcctgtttttagagaagatttgataatcagaagggca
gaattgggagataatgctgctatttgcggaatagtaagagaacttttttaa

DBGET integrated database retrieval system