KEGG   Clostridium sp. BNL1100: Clo1100_3148Help
Entry
Clo1100_3148      CDS       T01708                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:clb01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:clb01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:clb00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:clb00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:clb00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:clb00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:clb00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3589000..3589983)
Genome map
AA seq 327 aa AA seqDB search
MSDIKTIGVLTSGGDAPGMNAAIRAVVRTGIYHGFKMLGIRKGYNGLITGDIFDMSARDV
SDIIHRGGTILQTARCKAFTTDEGMQKAMSISKAFGMDALVVIGGDGSYRGARDFSKFGM
KVMGLPGTIDNDIASSEYTIGYDTAMNTVQDALDKIRDTAYSHERCSVLEVMGRRAGHIA
LNVGIAGGAEVVLLPEREFDFDKDIIRKIIQGRNSGKKNYIIILAEGVAEKIGGALELAK
KIEDLTGIETRGTVLGYIQRGGSPTIQDRVMASVMGAKAVTLLKDGVFNRIISVKDSKVV
DIDIDEALAMKKDIDKELFELSNILSI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattaaaacaataggagtacttaccagcggcggagatgcacctggaatgaat
gctgccatacgtgctgttgtaagaacaggtatatatcacgggttcaagatgctgggcatc
aggaaaggttacaatggtttaattaccggagatatatttgatatgagtgccagagatgta
tccgatattattcaccgtgggggaacgatacttcaaactgccagatgtaaggcatttaca
actgacgaaggcatgcagaaggctatgtctatttcaaaagcttttggtatggatgcactt
gttgttatcggcggtgacggttcatacagaggagctagagatttcagcaaattcggtatg
aaggttatgggattgccgggaacaattgataatgacatagcaagttcagaatatacaata
ggttacgatacagcaatgaatactgttcaggatgcgcttgacaaaatcagagatacggca
tattcacatgaacgatgcagcgtacttgaagtaatgggacgtcgtgcaggacatatagct
ttgaatgtaggaatcgcaggaggtgcggaagtagttctccttcctgaaagagaatttgat
tttgataaagatataataagaaaaattattcagggaagaaatagcggaaagaaaaactat
ataatcatattggctgaaggtgttgctgagaaaatagggggagcactggagcttgccaag
aagatagaagaccttaccggaatagaaaccagaggaacagttttgggatatatccaaaga
ggtggaagtccgactattcaggacagagttatggcaagtgttatgggagcaaaagctgta
acattgcttaaagatggtgtctttaacagaattatatctgtaaaggattcaaaagttgtt
gatatagatatagatgaagcattagccatgaagaaggatatcgacaaggagctgtttgaa
ctaagcaatatcctttcaatataa

DBGET integrated database retrieval system