KEGG   Clostridium sp. BNL1100: Clo1100_3623Help
Entry
Clo1100_3623      CDS       T01708                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
clb  Clostridium sp. BNL1100
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clo1100_3623
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Clo1100_3623
Enzymes [BR:clb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Clo1100_3623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4098791..4099609)
Genome map
AA seq 272 aa AA seqDB search
MCFKRQKLQDAQRIVIKVGTSTLTYETGKINFTCIDKLARIISDLSNQGKEVVLVTSGAI
GVGVDKLKLPERPKTIREKQAVAAVGQCELMHMYSKFFSEYGHIVAQILLTRDIMGDDKC
RKNVVNTFETLLEKGIVPIVNENDSVSTVELKVGQKDTFSENDTLSAIVAKIIEADLLII
LSDIDGFYDSDPRKNPDSKMLSVIDKITPEIEECAEGAGTKRGTGGMVTKLSAAKIATGA
GVDVVLTNGSHPEAILDILSGEQVGTLFIGSK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttcaaaagacagaaacttcaggatgcacaaaggattgtcattaaagtaggtact
tctactttgacatatgagaccgggaaaattaattttacttgtatagataagctggcaaga
attatttcagatttatcaaatcaaggcaaagaggtagtactggtaacttcaggagctatc
ggggtaggcgttgataaactcaaattgcctgaaagacctaaaaccattagagaaaagcag
gctgttgcagcagtaggacaatgtgaacttatgcatatgtacagcaaattcttttcagaa
tacggacatattgttgctcaaatcctattaacaagggacataatgggtgacgataaatgc
cgtaaaaatgttgttaatacatttgaaactcttttagaaaagggtattgttcctatagta
aatgagaatgactctgtttctaccgtggaacttaaagtaggacaaaaggatacctttagc
gaaaacgatacactgtctgctattgtagcaaagattatagaggctgatttactcataatt
ttatcggatatagacggtttttacgattctgatcctaggaagaatcccgattcaaagatg
ttatccgttatagataaaattactcctgagattgaggagtgtgccgaaggtgcgggaacc
aaacgaggcacaggaggaatggtaacaaagcttagtgctgcaaaaatagctacaggtgca
ggggtagatgtggtactgacaaacggtagtcaccccgaagcaattcttgacatattaagc
ggagaacaggttggtacactgtttattggatcaaaatag

DBGET integrated database retrieval system