KEGG   Clostridium sp. BNL1100: Clo1100_3852Help
Entry
Clo1100_3852      CDS       T01708                                 

Definition
(GenBank) alcohol dehydrogenase, class IV
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
clb00010  Glycolysis / Gluconeogenesis
clb00071  Fatty acid degradation
clb00350  Tyrosine metabolism
clb00620  Pyruvate metabolism
clb00625  Chloroalkane and chloroalkene degradation
clb00626  Naphthalene degradation
clb00650  Butanoate metabolism
clb01100  Metabolic pathways
clb01110  Biosynthesis of secondary metabolites
clb01120  Microbial metabolism in diverse environments
clb01130  Biosynthesis of antibiotics
clb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1100_3852
   00620 Pyruvate metabolism
    Clo1100_3852
   00650 Butanoate metabolism
    Clo1100_3852
  Lipid metabolism
   00071 Fatty acid degradation
    Clo1100_3852
  Amino acid metabolism
   00350 Tyrosine metabolism
    Clo1100_3852
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Clo1100_3852
   00626 Naphthalene degradation
    Clo1100_3852
Enzymes [BR:clb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Clo1100_3852
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Clo1100_3852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AEY67965
UniProt: H2J9E8
Position
complement(4316409..4319012)
Genome map
AA seq 867 aa AA seqDB search
MTKKNLVVNSVDTLLEKLAEIRKAQQEYSTFTQEQVDKIFLAASLAANKKRIPLAKMAQA
ETGMGVIEDKVIKNHYAAEYIYNAYKDTQTCGVIERDEAFGITKIAEPLGVVAAIVPTTN
PTSTAIFKALIALKTRNGIIFSPHPRAKKSTIEAANIILEAAVAAGAPKGIIGWVDEPTI
ELSERVMKEADIILATGGPGMVKAAYSSGKPAIGVGPGNVPAIIDESADIKTAVSSIIVS
KTFDNGMICASEQSVIVLDKIYNEVKKEFILRGAYMLNKEETQKVREVILVNGALNAKIV
GQTAHTIAKLAGFEVPVEAKVLVGEVESVELSEAFAHEKLSPVLAMYKAKSFDDAVLKAE
RLIADGGFGHTASLYIDTVNSKDKLDKFTAAMKTCRIVINTPSAQGGIGDLYNFKLAPSL
TLGCGSWGGNSVSENVGVKHLINIKTVAERRENMLWFRAPEKVYFKKGCLGVALRELKTE
MNKQRAFIVTDSFLYNNGYTKAVTNLLDDMNIKHHTFFDVAPDPTLACAKLGAEAMRDFK
PDVIIAIGGGSAMDAGKIMWTMYEHPEVDFQDLAMRFMDIRKRVYTFPKMGEKAYFVAIP
TSAGTGSEVTPFAVITDEQSGVKYPLADYELMPKMAIVDADLMMNMPKGLTSASGIDALT
HALEAYASMLSTDYTKGLALQATKSIFEYLPSAYENGAKDSIAREKMADASTMAGMAFAN
AFLGVCHSMAHKLGAFHHLPHGVANALLITEVMKFNIAEAPVKMGAFSQYKYPEILKRYA
EVASFIGITGSSDEEKFKKLLAKIDELKAKIGLPKTIKEAGVNEEKFLATLDEMVEQAFD
DQCTGANPRYPLLSEIKDMYLKVYYGK
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgactaagaaaaatttggtagtaaatagtgtagacactctgttggaaaaactggcagag
ataaggaaggcacagcaagaatattcaacatttacacaggaacaggttgacaagatattt
ctggctgcttcacttgctgctaataaaaagagaattcctcttgctaaaatggctcaggct
gaaacaggaatgggtgttatagaagataaggtaatcaaaaatcattatgcagcagagtac
atttacaacgcatataaggatacacaaacctgcggtgttattgaacgtgatgaagctttt
ggtattacaaagatagctgaacctcttggtgttgttgcagcaattgtgccaactacaaac
ccaacttcaacagctattttcaaggcacttattgctttgaaaaccagaaacggaattata
ttctcaccacatccaagagcaaagaagtccactatcgaggccgcaaacataatattggaa
gcagctgttgcagcaggtgcaccaaagggaatcatcggatgggttgatgagcctacaata
gagctttccgaaagagttatgaaggaagcggatataatacttgctacaggcggacccggt
atggttaaggctgcatactcatcaggaaagccggcaataggcgttggacccggtaacgta
cctgcaataattgacgaaagtgccgatataaagacagctgtaagttcaatcattgtttca
aagacatttgacaacggtatgatttgtgcttctgagcagtcagtaatcgttttagataaa
atatacaacgaagtaaaaaaagagtttattctcaggggcgcttacatgctcaataaagaa
gaaactcaaaaagtgagagaagttatattggttaacggtgcattaaatgcaaaaatcgtt
ggtcagacagctcacactattgcaaaattagcaggttttgaagttccggttgaagcaaag
gtattggtaggagaggttgagtcagttgaattgtctgaagctttcgcacatgaaaagctt
tcacctgtacttgcaatgtacaaggcaaagagcttcgatgacgctgtattaaaggctgaa
agacttatagcagacggcggattcggtcatactgcttcattatatattgatactgtaaac
agcaaggataaacttgataaattcactgcggcaatgaagacttgcagaattgttataaat
acaccatctgcacagggaggaatcggagacctctataactttaaacttgctccttcactt
acccttggttgcggttcatggggcggcaactccgtttcagaaaatgtcggagtaaagcat
ctgattaatattaagactgttgccgagaggagagagaatatgttgtggtttagagcgcct
gaaaaagtttatttcaagaaaggatgccttggtgttgcattaagagaactcaagactgag
atgaataagcaaagggcattcatagttacagactcattcctttacaacaacggatatact
aaagctgttaccaatcttttggatgatatgaatatcaagcatcatactttctttgatgta
gctccggacccgactcttgcttgtgccaagcttggtgctgaagcaatgagagatttcaag
cctgacgttatcatagcaataggcggaggttccgcaatggacgcaggtaagatcatgtgg
acaatgtatgaacatcctgaagttgatttccaggatctcgcaatgagatttatggatatc
agaaaaagagtatacacattccctaagatgggcgagaaggcatactttgttgcaatcccg
acatcagcaggaacaggttcagaggtgacaccgtttgcagttattactgacgaacagtca
ggtgtaaagtatcctcttgcagactacgaacttatgcctaagatggcaatagttgatgca
gaccttatgatgaacatgcctaagggtcttacatcagcttccggtatagatgctttgaca
catgctcttgaagcatacgcttcaatgctttcaacagattatacaaaaggtcttgcttta
caggcaacaaagagcatttttgaatatttaccttcagcatatgagaatggtgcaaaagat
tctatagcaagagaaaagatggctgatgcatcaacaatggccggtatggcctttgcaaac
gcattcctgggtgtttgccactcaatggcccacaagctgggagcattccaccacctgcct
cacggtgtggcaaatgcactgttgattactgaagtaatgaagttcaacatagccgaagct
cctgtaaagatgggtgcgttctcacagtataagtaccctgaaatactcaagaggtatgct
gaagtagcatcctttatcggaattacaggttccagcgatgaagaaaaattcaaaaagctt
ttagctaaaatagatgaattaaaagcaaaaataggattgcctaagactatcaaggaggca
ggcgtgaatgaggaaaaattccttgcaaccttggatgaaatggttgaacaggcattcgat
gatcagtgcacaggtgccaacccaagatacccactcttgagtgaaatcaaggatatgtac
ctgaaagtttactacggcaagtaa

DBGET integrated database retrieval system