KEGG   Clostridium sp. BNL1100: Clo1100_3870Help
Entry
Clo1100_3870      CDS       T01708                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
clb  Clostridium sp. BNL1100
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clo1100_3870
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clo1100_3870
Enzymes [BR:clb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Clo1100_3870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4338591..4339379
Genome map
AA seq 262 aa AA seqDB search
MILNKIAEHTKIRVENLKKEVPFDFVKSEALKLVNKSPFAFEKAINNGELNFICEIKKAS
PSKGLISENFPYIDIAKDYEAAGAGAISVLTEPEFFLGNDRYLKDVKKTVSIPVLRKDFT
IDPYQIYEAALIGADCVLLICSLLDTHTLKEYIKIVDSLGLSCLVEAHDETEVKSAIEAG
SRIIGVNNRNLKTFEVDITNSVRLRKLVPSDITFVSESGIRNAQDISVLRQIGVNAVLIG
ETLMRSGNAGAELEKLRSSAKN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatactgaataaaattgctgaacatacaaaaatacgtgttgagaatctaaaaaaggaa
gtgccttttgatttcgtaaaatctgaggccttaaaattggtaaataagagtccttttgct
tttgaaaaagcaataaataatggtgagcttaattttatatgcgagataaaaaaagcttct
ccttcaaaaggacttatctctgaaaattttccttatattgatatagctaaagattatgaa
gctgccggggccggagcaatctcggttttgacggaacctgaattttttcttggcaatgac
cgatatttgaaagacgtaaaaaaaacagtaagtattcctgttcttagaaaagattttact
attgacccgtatcagatttatgaagcggccttaataggtgcagattgtgtattgctgata
tgttccttgctggatactcatactttgaaagagtatattaagattgtggatagccttgga
ctgtcctgtcttgtggaagcccacgatgaaactgaagttaaaagtgcgattgaagccggc
agcaggataattggcgttaataacaggaatttaaaaaccttcgaagttgatataacaaac
agtgtacgccttagaaaacttgtaccctctgatataacttttgtatcggaaagcggtatc
cgcaatgctcaggatatttcagtactccgacaaataggggtaaatgccgttctgattggt
gaaacccttatgagaagcggcaatgcaggggcggaactggaaaagctgcggagttctgca
aaaaactag

DBGET integrated database retrieval system