KEGG   Clostridium sp. BNL1100: Clo1100_3873Help
Entry
Clo1100_3873      CDS       T01708                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clo1100_3873
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clo1100_3873
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clo1100_3873
Enzymes [BR:clb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clo1100_3873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4341199..4341969
Genome map
AA seq 256 aa AA seqDB search
MSKISNAFKNGKAFIGFLTAGDPSLEKTEEFVLEMVKAGADLIEIGIPFSDPIAEGEVIQ
RANIRALTNGTTMDKVFETVKRIRQKTQVPLVFLTYLNPVFTYGYDHFFRECSEYGVDGV
IIPDIPFEEKDELMPFSDKYNVDIISLIAPTSEERINKLASCAKGFVYCVSSKGVTGVRN
EIKTDLQSIVSSVRSATKIPVAVGFGISTSQQASEISKYADGIIVGSAIVKIIEQYGNDA
ATPLFDYVSNIKQSIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagtaatgcgtttaaaaatggtaaggcatttataggctttcttacagca
ggtgacccgtccttggaaaagactgaggaatttgttctggaaatggttaaggcgggtgct
gaccttatagagataggaattccgttttcagaccctattgcagagggtgaggttattcaa
agagcaaacataagggcattgacaaacggaacgactatggataaagtttttgaaacagtt
aaaaggataagacaaaagactcaggttccacttgttttcctaacttatcttaatcctgta
ttcacctacggttatgaccactttttcagagaatgtagtgagtatggcgttgacggtgtt
ataattcctgatattccatttgaggaaaaagacgaactgatgccttttagtgataaatat
aatgttgatatcatatcattaatcgcacctacctctgaggaacgtattaacaagttagct
tcctgcgcaaagggatttgtctactgtgtatcctcaaagggagttacaggtgtccgcaat
gaaataaaaacagacctgcagtcaattgtatcctctgtcaggtctgcgacaaaaattcct
gtagctgtgggctttggtatatccacctctcaacaggcatcagagatttctaaatatgct
gatgggattattgttggaagtgctattgtaaaaattatcgaacaatacggtaatgatgct
gcaacacctctatttgattatgttagcaacattaaacagtctataaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system