KEGG   Clostridium sp. BNL1100: Clo1100_3873Help
Entry
Clo1100_3873      CDS       T01708                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:clb01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:clb00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:clb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4341199..4341969
Genome map
AA seq 256 aa AA seqDB search
MSKISNAFKNGKAFIGFLTAGDPSLEKTEEFVLEMVKAGADLIEIGIPFSDPIAEGEVIQ
RANIRALTNGTTMDKVFETVKRIRQKTQVPLVFLTYLNPVFTYGYDHFFRECSEYGVDGV
IIPDIPFEEKDELMPFSDKYNVDIISLIAPTSEERINKLASCAKGFVYCVSSKGVTGVRN
EIKTDLQSIVSSVRSATKIPVAVGFGISTSQQASEISKYADGIIVGSAIVKIIEQYGNDA
ATPLFDYVSNIKQSIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagtaatgcgtttaaaaatggtaaggcatttataggctttcttacagca
ggtgacccgtccttggaaaagactgaggaatttgttctggaaatggttaaggcgggtgct
gaccttatagagataggaattccgttttcagaccctattgcagagggtgaggttattcaa
agagcaaacataagggcattgacaaacggaacgactatggataaagtttttgaaacagtt
aaaaggataagacaaaagactcaggttccacttgttttcctaacttatcttaatcctgta
ttcacctacggttatgaccactttttcagagaatgtagtgagtatggcgttgacggtgtt
ataattcctgatattccatttgaggaaaaagacgaactgatgccttttagtgataaatat
aatgttgatatcatatcattaatcgcacctacctctgaggaacgtattaacaagttagct
tcctgcgcaaagggatttgtctactgtgtatcctcaaagggagttacaggtgtccgcaat
gaaataaaaacagacctgcagtcaattgtatcctctgtcaggtctgcgacaaaaattcct
gtagctgtgggctttggtatatccacctctcaacaggcatcagagatttctaaatatgct
gatgggattattgttggaagtgctattgtaaaaattatcgaacaatacggtaatgatgct
gcaacacctctatttgattatgttagcaacattaaacagtctataaaataa

DBGET integrated database retrieval system