KEGG   Clostridium sp. BNL1100: Clo1100_4002Help
Entry
Clo1100_4002      CDS       T01708                                 

Definition
alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Clo1100_4002
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1100_4002
   00620 Pyruvate metabolism
    Clo1100_4002
   00650 Butanoate metabolism
    Clo1100_4002
  Lipid metabolism
   00071 Fatty acid degradation
    Clo1100_4002
  Amino acid metabolism
   00350 Tyrosine metabolism
    Clo1100_4002
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Clo1100_4002
   00626 Naphthalene degradation
    Clo1100_4002
Enzymes [BR:clb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Clo1100_4002
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Clo1100_4002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4480511..4483156
Genome map
AA seq 881 aa AA seqDB search
MAISNSDELLQKLTDIRAAQKVFATFSQAQTDEIFRQAAMAANNARIILAKMAVKETRMG
IVEDKVIKNHFASEYIYNKYKDEKTCGVIERDESFGVARVAEPVGVIAAIIPTTNPTSTA
IFKALLALKTRNGIIFAPHPRAKKCTVAAAKIILDAAVKAGAPEGIIGWIDEPSVELSQL
LMRESDLILATGGPGMVKAAYSSGRPAIGVGPGNTPVIIDETADLMMAVSSILLSKTFDN
GVICASEQAVIIMDQVYDAVKKEFIARGAHVLADEETDKVRNIILSNGALNAGIVGQSAC
KIAEMAGIKVAKDAKVLIGEVESVEKDEPFSHEKLSPILAMYRVSTFEDALKKAVRLIEL
GGFGHTSVLYTDEIKSRARIDQFGSTMKTGRTIINMPASHGAIGDIFNFKLPPSLTLGCG
TWGGNSVSDNVGVRNLLNMKTVAERRENMLWFRVPRKIYYKFGSLGVALRELSSMDKKKA
FIVTDKVLFQLGYTNKVTSLLDELEISYKIFSDVEPDPTLSAAKKGADEMESFKPDVIIA
VGGGSPMDAAKIMWVLYEHPEVKFEDLALRFMDIRKRVYTFPEMGRKALMISVPTSAGTG
SEVTPFAVITDDQTGIKYPLADYELTPNIAIIDAELMVNMPKGLTAASGIDALTHAIEAY
VSILATEFTNGLALEAIKLIFTYLPLAYNEGANNIEAREKMAHASTIAGMAFANAFLGIC
HSMAHKLGAMHHVPHGVANGILIGEVIRFNAVDNPRKQAAFAQYKYPNAKERYAEIADSL
KLGGNSVEEKINLLLQAIEDLKNKVNIPKTISEAGVPREKFYETLDEMCESAFDDQCTGA
NPRYPLICEIKQMYINAFEGTPGKLSDECDEIVCGDQTQGL
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atggcgatatcaaattctgatgaattattacagaaactcactgatataagagctgcacaa
aaagtatttgctacctttagtcaggcacagactgatgaaatattcaggcaagctgctatg
gctgcaaacaatgctaggatcatccttgccaaaatggctgttaaggagactcgaatgggc
atcgtggaagacaaggtgattaaaaatcactttgcctcagaatacatctacaataaatat
aaggatgaaaaaacttgtggtgtgattgaaagggatgaatccttcggagttgcacgagtt
gcagaacctgttggcgtaattgccgctatcattccgacaacgaatccaacttcaacagca
atattcaaggctttgctcgctctaaagactaggaatggtattatttttgccccccacccc
agggcgaagaagtgcaccgtagccgcagcaaagattatactggatgccgccgttaaggca
ggtgccccggaaggaatcataggatggattgatgaaccttccgttgaactttctcagctt
cttatgagggaatcagacttgattcttgcaacaggtggacctggtatggtaaaggcggcg
tattcatccggccgacctgccattggtgtaggcccggggaatactcccgtcatcattgat
gagacagccgatttaatgatggcagtaagctcgatcctattgtcaaaaaccttcgacaac
ggagtaatctgcgcttctgaacaagcagtaatcattatggatcaggtttatgacgcagta
aagaaagaattcattgcacgaggcgctcatgtccttgctgatgaagaaactgacaaggta
agaaatatcattctttcaaacggtgcgttgaacgcaggtattgttggacaaagtgcctgc
aagatagctgaaatggccgggataaaagtagcaaaagatgctaaagttcttattggcgaa
gtggaatccgttgaaaaagatgaacctttttctcatgaaaagctttctcccattctcgca
atgtatagagtaagcacctttgaagatgcactaaaaaaagcagtcaggcttatcgagctt
gggggattcggacacacatctgtgctttataccgatgaaattaaatccagagcacgaata
gaccaattcgggtctaccatgaaaacaggacgaaccattatcaatatgcctgcctcccat
ggtgccatcggtgacattttcaacttcaagctaccaccatcccttacccttggttgcggt
acctggggaggtaactctgtatcagataatgtaggagtacgcaacctgctaaatatgaaa
acagttgccgaaaggagagagaatatgctctggtttagagtcccgaggaaaatttactac
aaattcggcagcctgggcgttgcacttagagaattatccagtatggataaaaaaaaggcc
ttcatagtaaccgataaggttctgttccaattaggctacaccaataaggtcacaagtttg
cttgatgagcttgaaataagctacaagatattttctgatgtggaaccggatccaaccctt
tcagcagcaaaaaagggtgccgatgaaatggaaagcttcaaacccgatgttattattgca
gttggcggcggttcaccaatggatgctgctaaaatcatgtgggtgctttatgaacatcct
gaagtcaagtttgaagatctggccctgagatttatggatataagaaagagagtgtacacc
ttccctgaaatgggtagaaaagctctgatgatttccgttccaacctcagcaggtacaggc
tctgaagttactccttttgctgttattacagatgaccagacaggcatcaaatatccattg
gctgactacgaattaactcccaatattgccatcattgatgcagaacttatggtcaatatg
cccaaaggccttactgctgcttccggtatcgatgcattaacccacgccattgaagcttat
gtatccatccttgcaaccgagtttacaaatggattagctttggaagctattaagctgatt
ttcacttacctccctctagcctataatgagggtgccaataatattgaggccagagaaaaa
atggctcatgcctcaacgatagcaggcatggcttttgcaaacgcattcctgggaatatgt
cattcaatggctcataaacttggagcaatgcatcatgtgcctcacggtgttgcaaacggt
atactaattggagaagtaatccgatttaatgcagttgataatccaagaaaacaagcagca
tttgcacaatacaaatatccaaatgcaaaagagagatatgcagaaatcgctgattcactg
aaactgggtggtaacagcgtagaagaaaaaattaatcttctactgcaggccatcgaggac
ttgaagaacaaggtcaatatacccaagactataagtgaagccggtgtcccaagagaaaaa
ttctatgaaaccctggatgaaatgtgcgaatctgcatttgatgaccaatgtacaggcgcc
aatcccagatatcctctgatttgtgaaataaagcagatgtatatcaatgcattcgaaggt
actcccggtaaattgagtgatgagtgtgatgaaatagtctgcggagatcagactcaagga
ttataa

DBGET integrated database retrieval system