KEGG   Clostridium sp. BNL1100: Clo1100_4034Help
Entry
Clo1100_4034      CDS       T01708                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, alpha subunit
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clo1100_4034
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clo1100_4034
   00020 Citrate cycle (TCA cycle)
    Clo1100_4034
   00620 Pyruvate metabolism
    Clo1100_4034
   00640 Propanoate metabolism
    Clo1100_4034
   00650 Butanoate metabolism
    Clo1100_4034
  Energy metabolism
   00680 Methane metabolism
    Clo1100_4034
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clo1100_4034
Enzymes [BR:clb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Clo1100_4034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4519756..4520919)
Genome map
AA seq 387 aa AA seqDB search
MSNRVFVSGNEAVAIGVKLAKPNVIAAYPITPQTIVVERLAEMVERQELNAEYMYVESEH
SALSAVMGASVLGARTFTATSSQGLLYMAEVMHYASGGRVPLVMMNANRSLALPWSIFGD
QRDSLSMLDSGWIQVYVEDAQESLDMIIQSYALAEHKDVLTPVMVNLDGFVLTHTYEAIE
VPEEEQVDEFLPVFELEGKMDLENPRNLFFSSSPADNIRFKVQQHRAMENSREIIEILDK
QYGKITGRSYGGLATGYKTEDADILLITLGSITGQVRDAVDVLRAGGEKVGVVKIRFMRP
FPEKEILKLCSNAAVIGVLEKDISFGYHGTVYTNVADALKNTNKKLINFVGGLGGKNISQ
QDIEDIFNRLKNIDKDTNTVNFVGLEV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacagagtatttgtttcaggaaatgaagcagtagccattggtgtaaaacttgca
aagccaaacgtaatagccgcatatccaataacacctcaaaccatagtagtggaaagattg
gctgaaatggttgaaagacaggagctaaatgcggaatacatgtatgttgagtcggagcat
tctgcattatccgcagttatgggcgcaagtgtacttggagccagaacctttacagcgact
tcatcacaggggcttttatacatggcggaagtaatgcattatgccagcgggggtagggta
ccgttggtaatgatgaatgccaacagatcactggcccttccttggagtatattcggagac
cagagagattccttgtcaatgctggacagcggatggatacaggtttatgtggaggatgca
caagaaagtctggatatgataatacagtcatacgctctggctgagcacaaagatgtattg
actcctgttatggtaaacctcgacggatttgtattgacccacacatatgaagctatagag
gttccggaagaagagcaggtggacgaatttctgccggtctttgaacttgagggaaaaatg
gacttagaaaacccaagaaatttatttttctcatcaagtccggcggataatatacgattt
aaagtgcaacaacaccgggcaatggagaactcacgagaaataattgaaatcctggataaa
caatacggaaaaataacaggcagaagctacggaggtttggccacaggctacaaaacagag
gatgcggatatcctgcttattacattagggagtattaccggacaggtgagggatgcagtt
gatgtcctcagagcaggtggagaaaaagtaggggttgttaaaatcaggtttatgcgaccc
tttccggaaaaagaaatacttaagctttgcagtaatgcagctgtcataggtgtactggaa
aaggatatttccttcggatatcacggaacagtttatacaaatgttgctgatgccctcaaa
aacacaaataaaaaacttattaacttcgtaggcggtctgggtgggaagaatataagccag
caggacattgaagatatattcaatagattgaaaaatattgataaagacacaaataccgtc
aattttgtagggctggaggtgtag

DBGET integrated database retrieval system