KEGG   Clostridium sp. BNL1100: Clo1100_4043Help
Entry
Clo1100_4043      CDS       T01708                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
clb  Clostridium sp. BNL1100
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clo1100_4043
   00051 Fructose and mannose metabolism
    Clo1100_4043
Enzymes [BR:clb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Clo1100_4043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4529470..4530789)
Genome map
AA seq 439 aa AA seqDB search
MSEVFSGISNIKFEGSGSDNPLAFKYYNPKAVIGGKTMEEHLRFAVAYWHTFAAPGADMF
GAGSYVRPWNTMSDPLEIAKYKVEANFEFIEKLGAPFFAFHDRDIAPEGDTLAETNKNLD
VIVSVIKDRMKSSPVKLLWGTTNAFGNPRFMHGASTSPNADIFAYAAAQVKKAMEITKEL
GGENYVFWGGREGYETLLNTDMKLELDNLARFLKMAVDYAKEIGFDGQFLIEPKPKEPTK
HQYDFDTATVIGFLKTYGLDPYFKMNIEANHATLAGHTFQHELAMCRINNMLGSIDANQG
DVMLGWDTDQFPTNLYDSTLAMLEVLKAGGLTKGGLNFDSKVRRGSFEPADLFYGHIAGM
DTFAKGLIIANKIMVDGKFDAFVADRYSSYTTGIGKDIVEGKVGFKELEQHALNAKIQNK
SGRQEMLEALLNQYILEAK
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagtatttagcggtatttcaaacatcaaatttgaaggaagtgggtcagataat
ccattagcttttaagtactacaaccctaaggcagttatcggcggaaaaacaatggaagaa
catctgagatttgcagtagcgtattggcatacttttgcagcaccaggtgctgatatgttc
ggtgcaggatcatatgtaagaccttggaacacaatgtccgatcctctggaaattgcaaaa
tataaggttgaagcaaactttgaattcattgaaaagcttggagctcctttcttcgctttc
catgacagagatattgctccagaaggtgacacacttgctgaaacaaataaaaatcttgat
gtaattgtttcagtaattaaagatagaatgaaatcaagccctgtaaaactattatgggga
actacaaatgctttcggaaacccaagatttatgcatggtgcatcaacttcaccaaacgct
gacatatttgcgtatgcagcagctcaggttaagaaggcaatggaaatcacaaaggaatta
ggcggagaaaactatgtattttggggtggtagagaaggttatgaaactctattgaataca
gacatgaagctggaacttgacaatttagcaagattcttaaagatggctgttgactatgct
aaggaaattggttttgacggacagttcctaatcgaaccaaagccaaaggaaccaactaag
caccaatatgactttgatacagctacagttatcggcttcttaaagacatacggattggac
ccatacttcaagatgaatattgaagctaaccatgctacattggcaggacacacattccaa
catgaacttgctatgtgcagaatcaacaatatgcttggaagtatcgatgcaaaccagggt
gacgtaatgctcggatgggatacagaccaattcccaacaaacctgtatgattcaactcta
gcaatgttggaagtattaaaggctggcggattgacaaagggtggtctgaacttcgactca
aaagttagaagaggatcatttgaaccagctgacttgttctatggacatattgcaggtatg
gatacttttgcaaagggtcttatcatagctaacaagatcatggtagacggtaagtttgat
gcatttgttgctgacagatattcaagctacacaactggtatcggtaaagatattgttgaa
ggaaaagttggctttaaggaattagaacaacacgcacttaatgcaaagatccagaacaag
tccggacgtcaggaaatgctggaagctttgttaaaccaatatatactcgaagcaaaataa

DBGET integrated database retrieval system