KEGG   Clostridium sp. BNL1100: Clo1100_4064Help
Entry
Clo1100_4064      CDS       T01708                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase component beta subunit
Orthology
K00162  
pyruvate dehydrogenase E1 component subunit beta [EC:1.2.4.1]
Organism
clb  Clostridium sp. BNL1100
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:clb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:clb00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:clb00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:clb00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4553227..4554267)
Genome map
AA seq 346 aa AA seqDB search
MPWTTIEVEKQDKFIITDDSQNGRMISYKDALYEAMDQSLARDPRVFVMGEGVDDPGGVF
GTTKGLHEKYGRDRVFDTPIAENSLTGIAAGAAMAGLRPVFVHSRMDFLLLSLDQLVNHA
AKWSYMTGGKVSVPLVVRTVSARGWGSGAQHSQCLQGMLMNAPGLKIAAPATPYDAKGLL
ISSIIDNNPVLFVEHRWLYKTMGNVPDTLYSIPFGKGIVRRKGKDVTIVAVSYMLVEALK
AAEKLQAQNISAEVIDLRTIKPIDEDIIFESLAKTGKLIITDTGWKTGGVAAEIAALVAE
KAVHLLKKPVVRVCCPDIPTPAGDLQEKAFYPDFETICTKAVELMK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccctggactacaattgaagttgagaaacaggataaatttataataacggatgattcc
caaaatggcagaatgatttcatataaggatgctttgtacgaagcaatggaccaatccctt
gcaagagacccaagagtctttgttatgggagagggtgtagatgaccccggcggggttttt
ggaactacgaaaggattgcacgaaaagtatggccgtgacagggtttttgacacgccaatc
gcagaaaattccctgacaggaatagcagcaggagccgcaatggcaggattaagacctgtt
tttgttcatagcagaatggattttttgctgctttcattggatcaactggtaaaccacgct
gcaaaatggagctatatgaccggaggaaaggttagtgtacctttagtagtgagaacagtg
agtgcaagaggatggggatcgggagcccaacattcacaatgtttgcaggggatgcttatg
aatgctcccggactgaaaatagctgctcctgccacgccttatgatgccaagggattgctg
atttcaagcataattgataataatcctgtactatttgttgaacacagatggctttacaaa
acaatggggaatgtcccggacacactgtattccataccgtttgggaagggtattgtaaga
agaaagggaaaggatgttactattgttgcagtatcctatatgctggttgaagccttaaag
gcagcagagaagcttcaagcccagaatatatcggctgaggttatagatttaaggacaata
aaaccaatagacgaagacattatatttgaatcccttgcaaagacaggcaaacttataata
acagatacagggtggaagacaggcggtgttgccgcagaaattgcagccctcgttgctgaa
aaagctgttcatctgctgaaaaagcctgttgtaagagtttgctgtccggatataccaacc
ccggccggagatttgcaggagaaagccttttatcctgactttgaaactatatgcacaaag
gccgttgaattaatgaaataa

DBGET integrated database retrieval system