KEGG   Clostridium sp. BNL1100: Clo1100_4064Help
Entry
Clo1100_4064      CDS       T01708                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase component beta subunit
  KO
K21417  
acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta [EC:1.1.1.-]
Organism
clb  Clostridium sp. BNL1100
Brite
Enzymes [BR:clb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Clo1100_4064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4553227..4554267)
Genome map
AA seq 346 aa AA seqDB search
MPWTTIEVEKQDKFIITDDSQNGRMISYKDALYEAMDQSLARDPRVFVMGEGVDDPGGVF
GTTKGLHEKYGRDRVFDTPIAENSLTGIAAGAAMAGLRPVFVHSRMDFLLLSLDQLVNHA
AKWSYMTGGKVSVPLVVRTVSARGWGSGAQHSQCLQGMLMNAPGLKIAAPATPYDAKGLL
ISSIIDNNPVLFVEHRWLYKTMGNVPDTLYSIPFGKGIVRRKGKDVTIVAVSYMLVEALK
AAEKLQAQNISAEVIDLRTIKPIDEDIIFESLAKTGKLIITDTGWKTGGVAAEIAALVAE
KAVHLLKKPVVRVCCPDIPTPAGDLQEKAFYPDFETICTKAVELMK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccctggactacaattgaagttgagaaacaggataaatttataataacggatgattcc
caaaatggcagaatgatttcatataaggatgctttgtacgaagcaatggaccaatccctt
gcaagagacccaagagtctttgttatgggagagggtgtagatgaccccggcggggttttt
ggaactacgaaaggattgcacgaaaagtatggccgtgacagggtttttgacacgccaatc
gcagaaaattccctgacaggaatagcagcaggagccgcaatggcaggattaagacctgtt
tttgttcatagcagaatggattttttgctgctttcattggatcaactggtaaaccacgct
gcaaaatggagctatatgaccggaggaaaggttagtgtacctttagtagtgagaacagtg
agtgcaagaggatggggatcgggagcccaacattcacaatgtttgcaggggatgcttatg
aatgctcccggactgaaaatagctgctcctgccacgccttatgatgccaagggattgctg
atttcaagcataattgataataatcctgtactatttgttgaacacagatggctttacaaa
acaatggggaatgtcccggacacactgtattccataccgtttgggaagggtattgtaaga
agaaagggaaaggatgttactattgttgcagtatcctatatgctggttgaagccttaaag
gcagcagagaagcttcaagcccagaatatatcggctgaggttatagatttaaggacaata
aaaccaatagacgaagacattatatttgaatcccttgcaaagacaggcaaacttataata
acagatacagggtggaagacaggcggtgttgccgcagaaattgcagccctcgttgctgaa
aaagctgttcatctgctgaaaaagcctgttgtaagagtttgctgtccggatataccaacc
ccggccggagatttgcaggagaaagccttttatcctgactttgaaactatatgcacaaag
gccgttgaattaatgaaataa

DBGET integrated database retrieval system