KEGG   Caldicellulosiruptor lactoaceticus: Calla_0206Help
Entry
Calla_0206        CDS       T01600                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
clc  Caldicellulosiruptor lactoaceticus
Brite
Enzymes [BR:clc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Calla_0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
236787..241568
Genome map
AA seq 1593 aa AA seqDB search
MRKRAIALFVTLIFVMSILSPGYLPFLSTKANAQTQNTPTILRFDFESGNQGWTGRGLST
TVATVYNVAYEGDYSLKVSGKNASWDGAVIDLTDKLSANVSYTVSLFVHHSDPKPQRFSI
YAYVKDSASEKYIPVVDKVAVPNYWKQLVGKFTINTSNPVEKLQLLVCVPTSRSLEFFID
SVVIASTASVPSGVVKSTNFESGTTEGWQARGTGSDAQISVVSTIAHTGSKSLYVTGRVQ
TWQGAQIDLTSLLEKGKEYQFSVWVYQDSGSDQKLTLTMQRKNADGSTNYDTIKWQQTVS
SNTWVELTGSYTVPTTATQLIFYIESPNATLSFYIDDFTAVDKNAPVVAPGVVKSATFEG
GTTEDWQARGNGVTISVVNTVAHNGSKSLYVTGRSSTWHGAQIDLTSVLEKGKDYQFSVW
VYQDSGSDQKLTLTMQRQNADGTTNYDSIKYQQTVATNTWVELTGSYTVPTTATQLILYV
EAADTTLSFYIDDFTAVDKNPEVIPTVSRVPEWEIPSLFEQYTNYFSIGVAIPYKVLTNP
TEKAMVLKHFNSITAENEMKPDAIQKTEGNFTFNVADQYVDFAQQNRIGIRGHTLVWHQQ
TPNCFFQHSDGTPLDPSNPADKQLLRDRLRTHIQTLVGRYAGKIYAWDVVNEAIDENQPD
GYRRSEWYRILGPTDTTDGIPEYILLAFQYAREADPNTKLFYNDYNTENPKKRQFIYNLV
KKLKERGLIDGVGLQCHINVDSPTVKEIEDTIKLFSTIPGLDIHITELDISVYTSSSQRY
DTLPQDIMIKQALKFKELFEMLKRYSYVVTNVTFWGLKDDYSWLSTSRPDWPLLFDNNYQ
AKYNYWAIVEPSVLPLAINKGYANNASARIDGVLDREYKGAIPIKITNESGQEVASVQAL
WNPNELSLYISVNDTTIDAANDKVVVFVDQDNGKMPEIRPDDYWVSVTRTGAKAQSAQGY
VKDYAVVQQANGYVVELKLLINNTLTVNSSIGFDVAIFDNEVQYSWNDKTNSQFIETDNY
GILTMADSVKFASAPKGKAIIDAELDDTWKNAQEITTDTKVTVTGTVYDSAYAKAKMMWD
ENSIYVYAIVYDPLLNKANTNPWEQDSIEIFVDENNHKTPYYENDDVQYRVNYENTQTFG
TNGAPQNFITATKIIPNGYIVEAKVYMRTTKLSEGMVIGFDIQVNDADHTGKRVGVLTWN
DKVGNNYRDTTKFGCLELVAAPVSQPPIQAPSPSQPTTITYILTPTPTQPSTQTQQQPAQ
QPSQQQQQPQQQQPAQTQQPQTQPAQKPQNVVSVKIDQTKTETFTVGADTKVVVPQGSVT
GANAIVTVEKVAKLENNVGIGAVIATPVKVSIESGNIAKPIQIELKVDPAAFKDDRIPIA
FVYDDSKGKWTPVATKKAINTVTVATTKAGTVAVVAVKLEDVYKDISKEHWAYNTFKQAI
TSGLIVGYEDMTLKPAKNVTFAEAAVVAQRAFEITPKDYNKLANVPDWASLAVKSLIDNE
IVTEIDNVNKPLTRIEAVSIIMKLLEKAGVTAEPAELEFSDLFEQSSIDVEYLSKAYKLG
IVKGYTDGTFRPQNTITRAELLTLLIRALNYVK
NT seq 4782 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaaagagcaatagctttatttgtaactctcatctttgtcatgtctattttaagt
ccaggatatcttccatttctgagtactaaagcaaatgctcaaacacaaaatacaccaaca
attttaagatttgattttgaaagcggtaatcaaggctggacggggagaggtctttcaaca
actgttgcaaccgtttacaatgttgcttatgaaggtgattattcattaaaagtttctggc
aaaaatgcttcatgggatggagctgttattgatttaacagacaagctttcggcaaatgtg
agttatacagtttctttgtttgttcatcacagtgatccaaaacctcaaagattttcaata
tatgcatatgtaaaagattcagcaagtgagaagtatattcctgttgtagataaagttgca
gttcctaattattggaagcaactggttggtaaattcacaattaacacttcaaatccagtc
gaaaagctccagcttcttgtctgtgttcctacaagtagatcattggagttttttattgat
agtgtagtaattgcaagtactgcatcagtgccatctggagttgtaaaatctacaaatttt
gaaagtggtacaacagaaggttggcaagcaaggggaacaggttctgatgctcagattagt
gttgtttcgacaatagcacatacggggagtaaaagcttgtatgtgacagggagagttcaa
acgtggcaaggtgcgcaaatagatttgacaagtttgttagagaagggtaaagaatatcag
ttttctgtgtgggtatatcaggatagcggaagcgaccaaaagctgacactaaccatgcaa
aggaaaaatgcagatggaagtacaaattatgatacaataaaatggcagcaaacagtttca
agcaatacatgggtagagctgacaggttcatatacagtgccaactacggcaactcagctg
atattctacattgaatcacccaatgctaccctgagcttttatattgatgattttacagct
gttgataaaaatgccccagttgtagcgccaggagttgtaaaatcagcgacatttgagggc
ggtacaacagaagactggcaagcaagaggaaatggagtaactatttctgttgttaacaca
gtggcacataatgggagcaagagtttgtatgtgacagggagaagttcaacttggcatggt
gcacagatagatttaacaagtgtattggagaaaggcaaggattatcaattttctgtgtgg
gtatatcaggatagtggaagcgatcagaagctgacattgaccatgcagaggcaaaacgca
gatggcacaacaaattatgattctataaaatatcagcagacagtagcaacaaatacatgg
gtagagctaacaggttcatatacagtgccgacaacagccacccagttaattttatatgtt
gaagctgcagatactaccctaagcttttatattgatgattttactgctgttgataaaaac
ccagaggtaataccaacagtatcgagagtaccagaatgggaaattccttcactctttgag
cagtatacgaattatttcagcattggtgtggcaataccatataaagtacttacaaatcca
accgaaaaggcaatggtactcaaacatttcaacagtataacagctgagaatgaaatgaaa
cctgatgctattcaaaagacagaagggaattttacatttaatgttgcagaccaatacgta
gattttgcacagcaaaatagaattggaatcagaggtcacactcttgtttggcatcagcaa
acaccaaattgtttcttccagcatagtgatggtactccgcttgatccaagcaatcctgct
gacaaacaacttctacgcgatagattaagaacgcatatccaaacacttgttggaagatac
gcagggaaaatttatgcatgggatgttgtaaacgaggcaattgacgagaaccagccagat
ggatacagaagaagtgaatggtacagaatattggggccaactgatacaacagatggcatt
ccagaatatattctgcttgcattccagtatgcaagagaggcagacccaaatactaagctc
ttttataacgactataatacagaaaatccaaagaaaagacagtttatatacaatcttgtt
aagaagctcaaagaaagaggcttgattgatggtgtaggtctgcagtgccatattaatgtc
gattcacctacagttaaagagatagaggatacaattaaactgtttagtacaatccctggc
ttagacattcacattacagagcttgacattagcgtttatacaagcagcagccagagatat
gatactcttccacaggacataatgataaaacaggctttgaagttcaaagagctttttgag
atgctaaaaagatatagctatgttgtcacaaacgttactttctggggactcaaagatgac
tattcatggctttcaacaagcagacctgactggccactgctgtttgacaacaactaccag
gcaaaatataattattgggcaattgttgaaccgtcagtattgccacttgctataaacaaa
ggatatgcaaacaatgcatcagcaaggatagatggagttttagacagagaatacaaaggt
gcgattccaattaagattacaaatgaaagtggtcaagaagttgcaagtgtccaagcgctt
tggaatccaaatgaactcagcctctatatatcggtcaatgacacaacaatagatgctgct
aatgataaagtagttgtatttgtagaccaggataatggaaaaatgccagaaattaggcct
gatgattattgggtttcagttacaagaactggtgcaaaagcacaatcagctcaaggttat
gtaaaagattatgctgtcgtgcagcaagcaaatggatatgtggttgagttgaagctttta
attaataacacgttaactgttaactcttctataggctttgatgtagcaatctttgacaat
gaagttcaatatagctggaatgacaagacaaactcacagtttatagaaactgataactat
ggtattttaacaatggcagatagcgtcaagtttgcttctgctccaaaaggtaaagcaata
attgatgcagaattagatgatacatggaaaaacgctcaggaaataacaactgacacaaag
gtcacggttacaggcacagtatacgactcagcttatgcaaaggctaagatgatgtgggat
gaaaatagtatctatgtctatgcaattgtttatgacccgcttttgaacaaggctaataca
aatccatgggagcaggattcaattgagatatttgtggatgaaaataatcacaaaacgcct
tactatgaaaatgatgatgttcagtacagagtgaactatgagaatactcaaacatttggc
acgaacggtgctcctcagaacttcattacagcaacaaagataattccaaacggatatata
gtggaagctaaagtttacatgaggacgacaaagctttctgaaggaatggttataggcttt
gacattcaagtgaatgatgcagaccatacaggtaaaagagtcggtgttctaacctggaat
gataaggttgggaacaattatagagacacaacaaagtttggatgcttagagcttgtagca
gcacctgtaagccagccaccaatacaagctccatcaccatcacaaccaacaacaataacg
tatatactaacaccgacaccaacacagccatcaacccaaacacagcagcaacctgctcag
caaccatcacagcagcaacagcagccgcaacaacaacagcccgcacagacacaacaacct
cagacacagcctgcacaaaagcctcagaatgttgtttcagtaaagatagaccagacaaaa
actgagacatttactgttggcgctgataccaaggttgttgtacctcaaggttctgtaact
ggtgcaaatgcaattgttacagttgaaaaagtagctaagcttgaaaacaatgttggaata
ggtgcagttattgcaacacctgtgaaagtttcaattgaaagcggtaatattgcaaaacca
atacaaattgagttgaaagtagacccggcagcattcaaagatgatagaataccgatagca
tttgtatatgatgatagcaaaggaaagtggacacctgttgcaaccaagaaagctataaac
acagtaacagttgctactacaaaagctggaactgtggctgtagttgctgtcaaacttgag
gatgtatataaagatatttcaaaagaacattgggcatacaatacatttaaacaggctatt
acgtcaggattgattgtaggttatgaagatatgacattgaaacctgctaagaacgtgact
tttgcagaggctgcagttgttgctcaaagggcatttgaaataacacctaaggattacaat
aagcttgcaaatgtacctgactgggcatctttagcggtaaaatcgttgattgataatgaa
attgtcactgaaatagataatgttaataaaccacttaccagaatagaagcagtctcaatt
attatgaagcttttagaaaaagcaggtgttacagctgaaccagcagagcttgaatttagt
gatttgtttgagcagtcatctattgatgttgagtatttatccaaagcatacaaacttgga
attgtgaaaggatatactgatggtactttcagaccacaaaatacaataacaagagcagaa
ctgttgacgctgcttataagggctctgaattatgtaaaataa

DBGET integrated database retrieval system