KEGG   Caldicellulosiruptor lactoaceticus: Calla_0317Help
Entry
Calla_0317        CDS       T01600                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calla_0317
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calla_0317
   00052 Galactose metabolism
    Calla_0317
   00500 Starch and sucrose metabolism
    Calla_0317
   00520 Amino sugar and nucleotide sugar metabolism
    Calla_0317
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calla_0317
   00524 Butirosin and neomycin biosynthesis
    Calla_0317
Enzymes [BR:clc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Calla_0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
371134..372084
Genome map
AA seq 316 aa AA seqDB search
MYYIGIDLGGTNIAAGIVDEEGKIIKKGSVPTGAHRHYTEIMKDMAELSLNLVKECGLSL
DHIHSVGIGSPGTPDNEKGMILYSNNIAFLNVPMREEIQKYIPKPVNIENDANCAAYGEY
IAGGAKGTKISVTITLGTGIGGGIIIDGKIYTGAHHAGAELGHMVICVDGEQCTCGRKGC
WEAYASATALIRMTREAAARNINGTIMKLVNGDISKIDAKTAFDAKRMGDSEGAAIVDKY
VKYLAEGLVNVCNIFEPEVICIGGGVSKEGEYLLGPVRELVYEKFYCKQISPPKIIPAVL
GNDAGIIGAALLAKQI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgtattacatagggattgacttgggaggaacaaacattgcagcaggaattgtggatgaa
gaaggaaagattataaaaaaaggttctgttccaacaggtgcgcacaggcactacacagag
attatgaaagatatggcagagcttagcctcaatcttgtaaaagaatgcggactttcttta
gaccacattcactcagttggtattggaagccccggtacgcctgacaatgaaaagggcatg
attctttacagcaacaatattgcgtttttgaatgtgcctatgagagaagagatacaaaaa
tatattccaaagcctgtaaacatagaaaacgatgcaaactgtgcagcgtatggtgagtat
atagcaggcggtgcaaaaggcacaaagatttctgttacaatcacattggggactggcatt
ggcggtggaattataattgatggcaaaatatacaccggggcacatcatgcaggtgctgag
cttgggcatatggtgatttgtgttgatggtgagcagtgcacatgtggccgaaaagggtgc
tgggaagcgtatgcgtcagcaacagctcttattcgcatgacaagagaggctgctgcaaga
aatataaacggcacgattatgaaacttgtaaatggcgacatttctaagattgatgctaag
actgcctttgatgcaaagcgaatgggagacagcgaaggtgcagcaattgttgataagtat
gtaaaatatttagcagaagggcttgtaaatgtttgcaatatattcgaaccagaagtaatt
tgcattggcgggggagtcagcaaagaaggggaatacctgcttggaccggtaagagagctt
gtttatgaaaagttctattgcaaacaaatatcaccacctaaaataattcctgctgtctta
ggtaatgatgcaggtataattggtgctgcacttttggcaaagcagatttaa

DBGET integrated database retrieval system