KEGG   Caldicellulosiruptor lactoaceticus: Calla_0324Help
Entry
Calla_0324        CDS       T01600                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Calla_0324
Enzymes [BR:clc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Calla_0324
Exosome [BR:clc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Calla_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(379957..381921)
Genome map
AA seq 654 aa AA seqDB search
MIKKVKSTIYLSDIKKFESGEHFESYKFLGSRVVNYRGKVGTVFCVWAPNAKSVSVVGDF
NNWCGENHKMMRVYGSGFWWLFVEGIGEGELYKYEIIGADGKRVLKADPYAIFSELRPNT
ASIVKNIPDYDWHDQEWMEKRKTTPPYDKPINIYEVHLASWKMKKDGSIEKAGEFYNYRE
LAHMLVDYIKEMNYTHIELLPVLEHPLDMSWGYQPTGYFSLTSRYGSIEDFMYFVDIMHQ
NGIGVIVDWVPAHFCKDEHGLYRFDGTFLYEYEDELLRENYTWGTATFDFSKPQVQSFLI
SSAMFWFDVYHIDGIRVDAVSHIIYMNNNQKNRYGGHENIEGIEFIKKLNKAIFSKYPNV
LMIAEESTAFPLVTYPTYDGGLGFNYKWNMGWMNDTLKYMQKHPNERKHHHNLLTFSIMY
AFSENFILPFSHDEVVHGKKSLLDKMPGDYNQKFANLRLLYGYMYTHPGKKLLFMGGEFG
QFIEWRFYASLDWLLLDYPMHRMLQHYVKSLNRFYLENKALWELDHKMDGFRWIDVHNWQ
QSVISYLRFSKDPDDFLVVICNFGLASYENYKIGVPRKGVYLEVFNSDKAEFGGNNIVNT
EKLKTIDEVWHGYNQCIEFSLPALSCLIFKPVEFFDSKPEKVKDTDNNLLQGGG
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagtaaaatctactatttacctatctgacataaaaaaatttgaatcaggt
gagcatttcgaaagttacaagtttttgggaagcagggtagtaaactatagaggcaaagtt
ggaacagttttctgtgtgtgggcaccaaatgctaaaagcgtttctgttgttggagatttt
aataattggtgcggcgaaaatcacaagatgatgagagtttatggcagtggattttggtgg
ctgtttgtagaaggcattggcgaaggagaactttacaaatacgagattattggtgctgat
ggaaaaagggttttaaaagctgacccgtatgcaattttctctgagcttcgtcccaacaca
gcatcaattgtcaaaaacatcccggactatgactggcatgaccaggagtggatggaaaaa
agaaaaacaactccaccatatgacaagcccatcaatatctatgaagtccatcttgcatca
tggaagatgaaaaaggatggaagcatagagaaggctggtgagttttataattaccgtgaa
cttgcacacatgctggtagattacataaaagaaatgaactacacacacatagaacttctg
ccagttttggaacatccgcttgacatgtcctggggttaccagccaacaggttacttttct
ctcacatcacgctacggtagtattgaggattttatgtattttgtagatattatgcaccaa
aatggaattggagtaatagttgactgggtaccagctcatttttgcaaagatgagcatgga
ctttataggtttgacggaacgtttctttatgaatatgaagatgagcttttgagagaaaac
tacacgtggggtactgccacatttgacttttcaaagccacaggttcaaagtttcttaatt
tcaagtgcaatgttttggtttgatgtatatcacattgatggaataagggtagatgctgtt
tctcacatcatctacatgaacaacaaccagaaaaatagatatggcgggcatgaaaacata
gaaggaattgaatttataaaaaagctcaacaaggcaatattctcaaaatatccaaatgtc
ctgatgattgccgaagagtcaactgcatttcctttggtcacatatccaacatacgatggg
gggcttggttttaactacaaatggaacatgggatggatgaacgacaccttaaagtacatg
caaaaacatcccaacgagagaaaacatcatcacaatcttttgacattttccataatgtac
gcattttctgaaaactttattctgccgttttcacacgacgaggttgttcatggaaaaaaa
tctttgcttgacaaaatgccaggtgattacaaccagaaatttgcaaacttaagacttctt
tatggctatatgtacacacatccgggcaaaaagctccttttcatgggtggtgagtttggt
cagttcattgaatggagattttatgcatcacttgactggctacttctggactaccccatg
caccgcatgcttcagcactatgttaaaagtttaaataggttctatttagaaaacaaagct
ctgtgggagcttgaccataaaatggatggttttaggtggatagatgttcacaactggcaa
cagagtgtcatatcatacctgagattttcaaaagaccctgatgattttcttgttgttatt
tgtaactttggccttgcttcatatgaaaattataaaataggtgtgccaagaaaaggtgta
tatttggaagtatttaacagtgataaagctgaatttggtggtaataatatagtaaacaca
gaaaaacttaaaacaattgatgaagtatggcatggatataaccagtgcatagaatttagt
cttcctgctctttcgtgcttgattttcaaacctgttgagttttttgatagtaagcccgaa
aaggtcaaagatactgacaataacttattacaaggtggtggttaa

DBGET integrated database retrieval system