KEGG   Caldicellulosiruptor lactoaceticus: Calla_0352Help
Entry
Calla_0352        CDS       T01600                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Calla_0352
Enzymes [BR:clc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Calla_0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
409571..411838
Genome map
AA seq 755 aa AA seqDB search
MKKIILKSGILLLVVILIVSILQILPVFAQSTPYEKEKYPHLLGNQAVKKPSVAGRLQII
EKNGKKYLADQKGEIIQLRGMSTHGLQWYGDIINKNAFEALSKDWECNVVRLAMYVGEGG
YASNPSIKQKVIEGIRLAIENDMYVIVDWHVLNPGDPNAEIYKGAKDFFKEIATSFPNDY
HIIYELCNEPNPNEPGVENSLDGWKKVKAYAEPIIKMLRSLGNQNIIIVGSPNWSQRPDF
AIQDPINDKNVMYSVHFYSGTHKVDGYVFENMKNAFENGVPIFVSEWGTSLASGDGGPYL
DEADKWLEYLNSNYISWVNWSLSNKNETSAAFVPYVRGMHDATSLDPGDDKVWDIKELSI
SGEYVRARIKGIAYKPIERNSQIKEGETAPLGEKVLPSTFEDDTRQGWDWDGPSGVKGPI
TIESINGSKVLSFEVEYPEKKPQDGWATAARLILKEINAKREDNKYLAFDFYIKPERVSK
GMIQIFLAFSPPSLGYWAQVQDSFNIDLLKLSSARKTEEGLYKFNVFFDLDKIQDGKVLS
PDTLLRDIIIVIADGNSDFKGKMFIDNVRFTNILFEDISFESSLYDTVSKLYSKRVIKGT
SAFKYLPDRSITRAEFAALCVRTLNLKIEKYDGRFSDVKSSAWYSDVVYTAYKNGLFGQE
KNKFFPERIMKREEVAALAIEVYKRLTGKIEVSLDDIQIADEGLINPQYRESVKLAVKLG
IFELYSDGTFAPGKSISRGEVATIFYNLLNLAGKI
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattattttaaaatcaggtatactcttgttggtagttattttgattgtttct
attttgcaaattttacctgtgtttgcccagagcacaccatatgaaaaagaaaaatatcca
caccttcttggcaatcaggcagtcaaaaaaccctcggttgctggcagactgcaaattatt
gaaaagaacggtaaaaagtatttagctgatcaaaaaggtgaaataatccagcttcgtggc
atgagtacacatgggcttcagtggtatggtgatattataaacaaaaatgcgtttgaagct
ctttcaaaagattgggagtgtaatgttgtaaggcttgcgatgtatgtgggtgaaggcggc
tatgcttcaaatccaagcatcaagcaaaaagtcatagaagggattaggcttgctattgag
aatgacatgtatgtaattgttgactggcatgtattaaatcctggcgacccgaatgctgaa
atttataaaggggcaaaagactttttcaaagagatagctacaagttttcccaatgactat
cacataatatatgaactttgcaatgaaccgaatccaaatgaaccgggagtagaaaatagc
ttggatggttggaaaaaagtaaaggcttatgctgaacctataataaaaatgctcagaagt
ttggggaatcagaacattataattgtaggctctccaaattggagtcaaagacctgacttt
gcaattcaagacccaataaatgataaaaatgtgatgtattcagttcatttttattctgga
actcacaaggttgatgggtatgtttttgaaaacatgaaaaatgcatttgaaaatggtgtg
ccaatttttgtgagtgaatggggaacaagtttggcaagcggtgatggtggaccatatctt
gatgaggcggacaaatggcttgaatatctaaatagcaactatattagctgggtgaactgg
tcactgtcaaacaaaaatgaaacatcagctgcttttgttccatatgttcgtggcatgcat
gatgcaacatcacttgacccgggcgatgataaggtgtgggatataaaagagctgagtata
tctggagagtatgtgagggcaaggataaaaggaattgcatataagccaattgagagaaat
agccaaataaaagagggagaaactgcacctttgggagaaaaggttttgccatccacgttt
gaggatgacacgcgccagggttgggactgggacggtccgtctggtgtgaaaggacctatt
accatagaaagtataaatggttcgaaggtgctatcttttgaggttgagtatccagagaaa
aaaccgcaagatggctgggcaacggctgcaagacttatacttaaggaaataaatgctaag
agagaagataataagtatcttgcatttgacttttatataaaaccagaaagagtatcaaaa
ggtatgattcagatatttttagctttttcaccaccttctttaggttactgggctcaagta
caagacagttttaatattgaccttttaaagctttcaagtgcaagaaagacagaagagggg
ctttacaaattcaatgtattttttgacttagacaaaatacaggatggtaaagtgctgagc
ccagacacgctcttgagagatataataatagtcatagcagatggtaatagcgattttaag
ggaaaaatgtttatagacaatgttagattcaccaacatcctttttgaagacatcagcttt
gagagtagcctttatgatactgtctccaagctttattcaaaaagagtcataaagggaact
tcagcttttaagtacttgccagatagaagcatcacaagggctgaatttgctgcactttgt
gtcaggacattgaacctgaaaattgaaaagtatgacggcaggttttctgatgtaaaaagt
agtgcctggtattcagatgtggtctatactgcgtataaaaacggtttgtttggacaggag
aaaaataaattcttccctgaaaggattatgaaaagagaagaagtagcagctttggcaatt
gaagtatacaaaagattgacaggaaaaatagaagttagtctagatgatattcaaattgcc
gatgaagggcttataaatcctcaatacagagaaagcgtaaagttagctgtcaagcttggt
atttttgagctttattcagatggaacctttgctccaggtaagagcatttcaagaggggag
gtagcaacaattttctataacctcttgaacttagcaggcaagatatga

DBGET integrated database retrieval system