KEGG   Caldicellulosiruptor lactoaceticus: Calla_0452Help
Entry
Calla_0452        CDS       T01600                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:clc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Calla_0452
Enzymes [BR:clc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Calla_0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
514933..515532
Genome map
AA seq 199 aa AA seqDB search
MREGLLIVISGPAGTGKGTVVGRLLEKNPNIKLSISKTTRKPRPGEKEGVNYFFVSREQF
EEEIKNERFLEYAEYNNNYYGTPKDFVFEALEKGFDVILEIETQGALKIKKAFSDAVLIF
LLPPSIEELYRRLVKRGTESEDEIRARLEIAKNEIKLVSEYDYCVINDNVDDAAEKIQKI
IEVEKLKSRRFDIQSFLKE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagagagggacttttgattgtaatatcagggcctgcagggactggaaagggtacggtt
gtgggaaggcttcttgagaaaaatccaaatattaagctttcaatctccaagaccacgaga
aagccgaggccaggggaaaaagagggtgtgaactatttttttgtatcgcgcgagcaattt
gaagaagagattaaaaatgaaagatttttagaatatgctgagtataacaataactattat
ggtacgcccaaggattttgtctttgaggcattggaaaagggctttgatgtaattttggag
attgaaacacagggagcgctcaagattaaaaaagccttttcggatgcagtactaatattc
ttattgccaccatccatagaagagctttatagaagacttgtaaaaagaggcaccgagtct
gaagatgagataagagcaaggcttgagattgccaagaacgagataaaacttgtgtcagag
tatgactattgtgttataaatgacaatgtggatgatgctgctgaaaagatacaaaagatt
attgaagttgaaaaactaaagagtagacgatttgatatacaaagttttttgaaggagtga

DBGET integrated database retrieval system