KEGG   Caldicellulosiruptor lactoaceticus: Calla_0522Help
Entry
Calla_0522        CDS       T01600                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:clc00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:clc00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:clc00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
join(583757..583912,583914..585074)
Genome map
AA seq 438 aa AA seqDB search
MLKIAIIGAGSGVFTRNLVRDILSYPELRDSTIALMDIDSIRLEFMRKALQKLIDQEKYP
TKLEATTDRKEALKGAKYVVVTIQVGGLKPYEYDIYIPLKYGVKQAVGDTIGPGGVFRAL
RTIPVLLDIAKDMEELCPDALLLNYVNPMAMNCWALNKATNIKNVGLCHSVQGTAEFLAK
IIGAKMEEISYLCAGINHMAWFLKFEWNGKDAYPLIREKASDPEIYTQDVTKFEILKHFG
YYVTESSFHMSEYVPYFRKSDDWINKIHRTHSWHKEHYNGMYLHCCLDAAKTLLEDLRKM
AEADYIDPKRSNEYCATIIHSIETNSTSVINGNVENKGLITNLPEGCCVEVPCLVDKNGI
QPTYVGNLPPQLAALNRTNINVQELAVIAALTGDREAVYHAIMMDPLTSAVLDLDQIRQM
VDEMFEAEKEWLPEKFYR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatagctatcataggtgcaggaagtggagttttcacaaggaacttggtaaga
gacattttgtcatatccagaactaagagactctacaatagcgcttatggacattgacagt
ataagacttgaatttatgagaaaagctctgcaaaaactcattgaccaggaaaagtatcca
accaaacttgaagccacaactgatagaaaagaggctttaaaaggtgcaaaatatgtggtt
gtcacaatacaagttggaggtttaaaaccttacgaatatgacatttacattcctttaaaa
tacggtgtaaaacaggcagttggtgatacaataggtccaggtggagtttttagggctctt
agaacaataccagttttgcttgacattgcaaaggacatggaagagctttgtcctgacgca
cttttgctcaattatgtaaatccaatggcaatgaactgctgggcgttaaataaggctacg
aatataaaaaatgtagggctttgtcacagtgttcaaggaactgctgaatttttagcaaaa
attattggggcaaaaatggaagaaatttcatacttatgtgcaggtataaaccacatggca
tggtttttaaaatttgagtggaatgggaaagatgcatatcctcttataagggaaaaagca
agtgaccccgaaatctatacacaggatgttacaaaattcgagatactaaaacattttgga
tattatgtaacagagtcaagtttccatatgtctgaatatgttccctattttagaaagagc
gacgattggataaacaaaatacatagaacacattcatggcacaaagaacattacaatggc
atgtatctgcactgctgtttagatgctgcgaaaactttgcttgaagacctgaggaaaatg
gcagaggcagactacatcgaccccaagagaagtaacgaatactgtgcaactatcatccat
tccatagagacaaacagtacgagtgtaataaatggtaatgttgaaaacaaaggtttgata
acaaatttacctgaaggatgctgcgttgaagtgccatgcctggttgacaaaaatggtatt
cagccaacttatgttgggaatctaccaccacagcttgcagctttgaacaggactaatata
aacgtgcaggagcttgctgtgattgctgctttgacaggtgatagggaagcagtttatcat
gcaattatgatggaccctctcacaagtgctgttttggatttagaccagatacgccagatg
gtagatgagatgtttgaagctgaaaaagaatggctgccagaaaagttttataggtaa

DBGET integrated database retrieval system