KEGG   Caldicellulosiruptor lactoaceticus: Calla_0525Help
Entry
Calla_0525        CDS       T01600                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
clc  Caldicellulosiruptor lactoaceticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:clc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Calla_0525
Enzymes [BR:clc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Calla_0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
586304..586897
Genome map
AA seq 197 aa AA seqDB search
MIDSIVGIIQEVFSNYVIINYNNIYIKIFCNGTKFSEFLGKEKKVYVSLKFNENLSELEC
YGFLTREERELFLKLQKVTGVGSKLALQILSSIDFQELIVEIAKGNVARLEKVKGIGKKT
ASRIILELKETLKKEFKVVATTGKEEKTYEKLEEISLALLSLGYDIDEVNQVLSSEDFSE
LSLEDGIKLALKKLSKI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatagattctattgtgggaataattcaagaggtatttagtaactatgttatcatcaat
tataacaatatatacataaaaatattttgcaatggcacaaaattctctgaatttttaggc
aaagaaaaaaaagtgtatgttagcctaaagtttaacgaaaacttatcagagcttgaatgt
tatggttttttgacaagagaggaaagagagctttttttaaagcttcagaaggtaaccggt
gttggcagcaaattagctcttcagattctttcttcaatagactttcaagaacttattgtt
gagattgcaaaaggaaatgtagcaagacttgagaaggtaaaaggaattgggaaaaaaact
gcaagtaggataattcttgagctcaaagagacactcaaaaaagagttcaaagtagttgcc
actacaggtaaagaagaaaaaacttacgaaaaacttgaagaaatatctttagcactttta
tccttggggtatgacattgatgaagtcaaccaggttctttcatccgaagatttttctgaa
ctttctttggaagatggaataaaacttgctttgaaaaagttatcaaagatttga

DBGET integrated database retrieval system